Dbfetch

ID   BC019172; SV 1; linear; mRNA; STD; MUS; 962 BP.
XX
AC   BC019172;
XX
DT   14-DEC-2001 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus CD200 antigen, mRNA (cDNA clone MGC:29086 IMAGE:5003655),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-962
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-962
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8358d9039b7ba07d33b16babb1bf0b01.
DR   Ensembl-Gn; ENSMUSG00000022661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166512; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 39 Row: c Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543262.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..962
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:29086 IMAGE:5003655"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..962
FT                   /gene="Cd200"
FT                   /note="synonym: OX2"
FT   misc_difference 1..11
FT                   /gene="Cd200"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             57..509
FT                   /codon_start=1
FT                   /gene="Cd200"
FT                   /product="Cd200 protein"
FT                   /db_xref="GOA:Q05D16"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033321"
FT                   /db_xref="MGI:MGI:1196990"
FT                   /db_xref="UniProtKB/TrEMBL:Q05D16"
FT                   /protein_id="AAH19172.1"
FT                   /translation="MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHT
FT                   TASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNS
FT                   SITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYAHSTPSLQLF"
FT   misc_difference 218
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 407
FT                   /gene="Cd200"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 802
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 858
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 890
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 896
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 902..903
FT                   /gene="Cd200"
FT                   /note="in the mouse genome : AG."
FT   misc_difference 906^907
FT                   /gene="Cd200"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 910..911
FT                   /gene="Cd200"
FT                   /note="in the mouse genome : GA."
FT   misc_difference 919
FT                   /gene="Cd200"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 923
FT                   /gene="Cd200"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 929
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 935
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 937^938
FT                   /gene="Cd200"
FT                   /note="1 base in the mouse genome, A, is not found in
FT                   cDNA."
FT   misc_difference 941
FT                   /gene="Cd200"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 943
FT                   /gene="Cd200"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 948..962
FT                   /gene="Cd200"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 962 BP; 298 A; 225 C; 234 G; 205 T; 0 other;
     ccacgcgtcc gctcagaccc cgagaagctg gtgtctagct gcggcccaga gcaaggatgg        60
     gcagtctggt attcaggaga cctttctgcc atctctccac ctacagcctg atttggggca       120
     tggcagcagt agcgctgagc acagctcaag tggaagtggt gacccaggat gaaagaaagg       180
     cgctgcacac aactgcatcc ttacgatgtt ctctaaagac atcccaggaa cccttgattg       240
     tgacatggca gaaaaagaaa gccgtgagcc cagaaaacat ggtcacctac agcaaaaccc       300
     atggggttgt aatccagcct gcctacaaag acaggataaa tgtcacagag ctgggactct       360
     ggaactcaag catcaccttc tggaacacaa cattggaaga tgagggttgc tacatgtgtc       420
     tcttcaacac gtttggttct cagaaggtct caggaacagc ttgccttacc ctctatgccc       480
     atagtacacc ttcactacaa ctattttgaa gaccacctaa acatcacttg ctctgcgact       540
     gcccgtccag cccctgccat ctcctggaag ggtactggga caggaattga gaatagtacc       600
     gagagtcact tccattcaaa tgggactaca tctgtcacca gcatcctccg ggtcaaagac       660
     cccaaaactc aagttgggaa ggaagtgatc tgccaggttt tatacctggg gaatgtgatt       720
     gactacaagc agagtctgga caaaggattt tggttttcag ttccactgtt gctaagcatt       780
     gtttctctgg taattcttct ggtcttgatc tccatcttac tatactggaa acgtcaccga       840
     aatcaggagc ggggtgagtc atcacagggg atgcaaagaa tgaaataagg aagaagaaga       900
     agaagaagaa gaagaagaag aagaagaaga agaagaagaa gaagaagaaa aaaaaaaaaa       960
     aa                                                                      962
//