Dbfetch

ID   BC018504; SV 1; linear; mRNA; STD; MUS; 2628 BP.
XX
AC   BC018504;
XX
DT   10-DEC-2001 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus N-myc downstream regulated gene 3, mRNA (cDNA clone MGC:21649
DE   IMAGE:4500970), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2628
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2628
RA   Strausberg R.;
RT   ;
RL   Submitted (03-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; ecb35f9372a8c25cd89837edce07a6c7.
DR   Ensembl-Gn; ENSMUSG00000027634; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026772; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026738; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026709; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026747; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026489; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027196; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025951; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026466; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026604; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026571; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026709; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026592; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025685; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026021; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000069600; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058811; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0058832; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0058777; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058766; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058470; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059244; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058737; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0058435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0058539; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0058522; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0058670; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058497; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058302; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057749; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 28 Row: f Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7305306.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2628
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:21649 IMAGE:4500970"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2628
FT                   /gene="Ndrg3"
FT                   /note="synonym: 4833415O14Rik"
FT   CDS             93..1259
FT                   /codon_start=1
FT                   /gene="Ndrg3"
FT                   /product="Ndrg3 protein"
FT                   /db_xref="GOA:Q8VCV2"
FT                   /db_xref="InterPro:IPR004142"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR030692"
FT                   /db_xref="MGI:MGI:1352499"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCV2"
FT                   /protein_id="AAH18504.1"
FT                   /translation="MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVT
FT                   IRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSF
FT                   PTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINI
FT                   DPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENL
FT                   QLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPIN
FT                   TTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPYVQLSHLSSESVPSASMTRLARS
FT                   RTHSTSSSIGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC"
XX
SQ   Sequence 2628 BP; 691 A; 662 C; 610 G; 665 T; 0 other;
     gcctgtagat ggtgttgtag attgacggcc ccgcgctagc gcttcagagt tcctggttca        60
     tccttgagac tcatctgctc tgagccatcc tcatggatga acttcaggat gttcaactca       120
     cagagatcaa accgcttcta aatgataaga atggcacacg aaacttccag gactttgact       180
     gtcaggaaca tgacattgaa acaccgcatg gtatggtcca cgtcaccata agaggcttac       240
     caaaaggaaa cagacctgtt atcctgacat accacgacat tgggctcaac cataagtcct       300
     gcttcaacac attcttcaac tttgaggata tgcaagagat cacccagcac tttgctgtct       360
     gtcacgtgga cgctcctggc caacaagaag cagcaccctc cttccccaca gggtaccagt       420
     accccaccat ggatgagcta gctgagatgc tgcctcctgt tctcacacac ttaagtatga       480
     agagcatcat tggtattggg gttggagcag gagcctacat tctcagcaga tttgcactga       540
     atcatccaga gctggtggaa ggtcttgtgc tcattaacat tgacccgtgt gctaagggct       600
     ggattgactg ggcagcttcc aaactctcag gttttaccac caacattgtg gacataattc       660
     tggctcatca ctttggccag gaggagttgc aggccaattt ggacctcatt caaacctaca       720
     gactgcacat tgctcaagat atcaaccaag aaaacctcca gctcttcctg ggttcctata       780
     atgggcgcag agacctggag atcgaaaggc ctatactggg ccaaaatgat aacagattga       840
     aaacgctaaa gtgttctacc ttactggtgg tgggggacaa ttcacctgct gtggaggctg       900
     tggttgaatg taattctcgc ctcgacccta taaatacaac tttgctaaag atggcagact       960
     gtggaggact gccccaagta gttcagcctg ggaagctcac cgaggccttc aagtactttt      1020
     tgcagggaat gggctacatc ccgtatgtgc agctcagtca cctcagcagc gagtcagtac      1080
     catctgccag catgacccgg ctcgcccgat cacgaaccca ctccacctca agtagcattg      1140
     gctctggaga aagtcccttt agcaggtctg tgaccagcaa tcagtcagat ggaactcaag      1200
     aatcctgtga gtcccctgat gtcctggaca gacaccagac catggaagtg tcttgctaag      1260
     cagatctcct cccctggacc atgcaagtcc ctctccttga aatgaccact ccgtaataga      1320
     acatttcatt ccgtcagctg gcccccactt cctttcactc acgcatggcc acagcatctc      1380
     tctctagtag ccgagagtgt cattctctcc accctttctg tgtgtaccag agccacaccc      1440
     atgccattac tgtaacattc caacatctcc atctgacctg acctccatat cttctcttgc      1500
     cagcctttcc ctatgctccc tcaaatatgt atctgatgag attctttaat tcccaactcc      1560
     atgtgtgtgc gagcacgcgt gtctgtgtct gtgtgtgcat acttctgtga ctttagacat      1620
     gctttcttgt agtgcttctg caaagggact ttttttgaat cctcagtggc atttttttaa      1680
     gggaaatatg cagagtggat atctgggtgg gttgggccac aagattggat tttggttcca      1740
     cttggacaac aaacagtatt tgcagagtga tttcaggaga gagcaggtct gaggaatatg      1800
     caaaactgta gttactgtgt gggccattga ctgccttgac cagtagaagg gataactatt      1860
     acacagatag gcaggcaggg tggcagtcac ctcccctgtc cacgtggatc catccctgcc      1920
     attgtgtgag tcagagggat agatctgaag cctgtgaatg atgtctggta caccacagtg      1980
     ttttctccag agaactggcc taagctctag attagccaag aaagctggaa aacagagcgc      2040
     caggcttcac tctgcagaga gaaagtgctc tgtccctgta gcgtctgatt ccacttacca      2100
     gacacccacg catctgcagg atgtctgatg cagagcggtt ctccatccct cagttccaga      2160
     aaaaatggag tgatatttaa aaatgccatc gatggtgggg atcttactgg ggaagaggaa      2220
     ggaccattag cacaccatca tgatgtcaga tgacaaaatg gaagccaaga caccttgaag      2280
     gtgactttct aggaaggtct taagcatgta atgtcccttt atcagaggga aggggacaaa      2340
     ctcagggcag ccctgtccag gtagaaatat ttttgccccc ctgtctgatg ttgatgaggg      2400
     gtcataccag ccagggagac cctctgggag gaagctgcca cacacaagga ctctggaagt      2460
     atccagatgt gagcccagcc agggtcctat ggttccaaat ctgaagaaaa ggtttttcac      2520
     acactccttg ctttctgcta agataagaaa ggcgtcactc tgccagagtg tgacttttta      2580
     cagattaaat aaagctgtat atgtctcatt gttaaaaaaa aaaaaaaa                   2628
//