spacer

EBI Dbfetch

ID   BC017199; SV 2; linear; mRNA; STD; HUM; 1497 BP.
XX
AC   BC017199;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens paired-like homeobox 2b, mRNA (cDNA clone MGC:1678
DE   IMAGE:3161284), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1497
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1497
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-NOV-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6e2caa0f7c9964b47ce95eccd543adf7.
DR   Ensembl-Gn; ENSG00000109132; homo_sapiens.
DR   Ensembl-Tr; ENST00000226382; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:16877954.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 4 Row: n Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 12707579.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1497
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_19"
FT                   /clone="MGC:1678 IMAGE:3161284"
FT                   /tissue_type="Brain, neuroblastoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1497
FT                   /gene="PHOX2B"
FT                   /note="synonym: NBPhox"
FT   CDS             97..1041
FT                   /codon_start=1
FT                   /gene="PHOX2B"
FT                   /product="paired-like homeobox 2b"
FT                   /db_xref="GOA:Q99453"
FT                   /db_xref="H-InvDB:HIT000037869.17"
FT                   /db_xref="HGNC:HGNC:9143"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99453"
FT                   /protein_id="AAH17199.1"
FT                   /translation="MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYN
FT                   PIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTT
FT                   FTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAA
FT                   AAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAG
FT                   APGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPIT
FT                   SIPDSLGGPFASVLSSLQRPNGAKAALVKSSMF"
FT   misc_difference 1488..1497
FT                   /gene="PHOX2B"
FT                   /note="polyA tail: 10 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1497 BP; 299 A; 482 C; 462 G; 254 T; 0 other;
     cgttgagctg tgcacatctc cccactccag ccaccttctc catatccatc ttttatttca        60
     tttttccact tggctgagcc atccagaacc ttttcaatgt ataaaatgga atattcttac       120
     ctcaattcct ctgcctacga gtcctgtatg gctgggatgg acacctcgag cctggcttca       180
     gcctatgctg acttcagttc ctgcagccag gccagtggct tccagtataa cccgataagg       240
     accacttttg gggccacgtc cggctgccct tccctcacgc cgggatcctg cagcctgggc       300
     accctcaggg accaccagag cagtccgtac gccgcagttc cttacaaact cttcacggac       360
     cacggcggcc tcaacgagaa gcgcaagcag cggcgcatcc gcaccacttt caccagtgcc       420
     cagctcaaag agctggaaag ggtcttcgcg gagactcact accccgacat ctacactcgg       480
     gaggagctgg ccctgaagat cgacctcaca gaggcgcgag tccaggtgtg gttccagaac       540
     cgccgcgcca agtttcgcaa gcaggagcgc gcagcggcag ccgcagcggc cgcggccaag       600
     aacggctcct cgggcaaaaa gtctgactct tccagggacg acgagagcaa agaggccaag       660
     agcactgacc cggacagcac tgggggccca ggtcccaatc ccaaccccac ccccagctgc       720
     ggggcgaatg gaggcggcgg cggcgggccc agcccggctg gagctccggg ggcggcgggg       780
     cccgggggcc cgggaggcga acccggcaag ggcggcgcag cagcagcggc ggcggccgcg       840
     gcagcggcgg cggcggcagc ggcagcggcg gcagctggag gcctggctgc ggctgggggc       900
     cctggacaag gctgggctcc cggccccggc cccatcacct ccatcccgga ttcgcttggg       960
     ggtcccttcg ccagcgtcct atcttcgctc caaagaccca acggtgccaa agccgcctta      1020
     gtgaagagca gtatgttctg atctggaatc ctgcggcggc ggcggcggcg gcgacagcgg      1080
     gcgagccagg gcccgggcgg gcgagtgggc gagcgggtag gcccaaggct attgtcgtcg      1140
     ctgctgccat ggctttttca ttgagggcct aaagtaatcg cgctaagaat aaagggaaaa      1200
     cggcgtcgcc ctcatttcaa ccccactcct acccccttcc tcaaccccca aacaaaacaa      1260
     acaaacttcc ctggcttcgc acctgcctgg ggcctcgcag cggggccagg gctccgcctg      1320
     ctgatcgggg gttgtgagca gcgcggcctg gacgcggggc actctcaggg ggctgtgtct      1380
     gcgtgtcagt ttgtgtctgt ctcggggaat gtgtgtctgt ggcccaagca ggtgacagga      1440
     agagatgggg ggcctcaacc aacttagtga cttgtttaga aaaaaaaaaa aaaaaaa         1497
//


spacer
spacer