Dbfetch

ID   BC016884; SV 1; linear; mRNA; STD; MUS; 2814 BP.
XX
AC   BC016884;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus frizzled-related protein, mRNA (cDNA clone MGC:18388
DE   IMAGE:4237554), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2814
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2814
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-NOV-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f84e6efb0397f2630e80c0f066fd28cb.
DR   Ensembl-Gn; ENSMUSG00000027004; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026303; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025078; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025597; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025728; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025816; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025721; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025147; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000028389; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0055544; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055247; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055453; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055305; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055405; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0055255; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0055052; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054520; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 25 Row: i Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981490.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2814
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:18388 IMAGE:4237554"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2814
FT                   /gene="Frzb"
FT                   /note="synonyms: fritz, frzb-1, frezzled, Frp"
FT   CDS             404..1375
FT                   /codon_start=1
FT                   /gene="Frzb"
FT                   /product="frizzled-related protein"
FT                   /db_xref="GOA:P97401"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026556"
FT                   /db_xref="InterPro:IPR035813"
FT                   /db_xref="InterPro:IPR036790"
FT                   /db_xref="MGI:MGI:892032"
FT                   /db_xref="PDB:1IJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97401"
FT                   /protein_id="AAH16884.1"
FT                   /translation="MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKS
FT                   LPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEP
FT                   IKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPM
FT                   DSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEI
FT                   LKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDR
FT                   LGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPVRS"
FT   misc_difference 1138
FT                   /gene="Frzb"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1365
FT                   /gene="Frzb"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; amino acid
FT                   difference: 'V' in cDNA, 'A' in the mouse genome."
FT   misc_difference 1369
FT                   /gene="Frzb"
FT                   /note="'A' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1449
FT                   /gene="Frzb"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1480^1481
FT                   /gene="Frzb"
FT                   /note="2 bases in the mouse genome, GC, are not found in
FT                   cDNA."
FT   misc_difference 1498
FT                   /gene="Frzb"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1508
FT                   /gene="Frzb"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1510
FT                   /gene="Frzb"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1571
FT                   /gene="Frzb"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1573
FT                   /gene="Frzb"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1592
FT                   /gene="Frzb"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1686
FT                   /gene="Frzb"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1929
FT                   /gene="Frzb"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2315
FT                   /gene="Frzb"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2391
FT                   /gene="Frzb"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2420
FT                   /gene="Frzb"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2544
FT                   /gene="Frzb"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2591
FT                   /gene="Frzb"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2613^2614
FT                   /gene="Frzb"
FT                   /note="2 bases in the mouse genome, TG, are not found in
FT                   cDNA."
FT   misc_difference 2621
FT                   /gene="Frzb"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2729
FT                   /gene="Frzb"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2767..2814
FT                   /gene="Frzb"
FT                   /note="polyA tail: 48 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2814 BP; 740 A; 668 C; 672 G; 734 T; 0 other;
     cgcttcttcc aacacctttt tgcaacaccc cagaactccg agtcccttaa ctgaatttga        60
     cttttgtttt tatttctctc tggcttcctc ttctgccccc tcatctgatt gatgtgctaa       120
     ggctgatgtc tctgccagag cgagaggaat aaatagatgc tgcctcgcct agaggcttag       180
     acgcttggga agagcagccg gcgcagcgag gcaccgggct ccgccaagct agtggaccgg       240
     acctgggagc acttggatcc aagagaactg tgattgtccc aggggtgggg gcagctcccc       300
     aggtcgttgg gatcacccct cggaaccgca gggggagact tcggaacgaa agtgtctccc       360
     gcgtccgtcg ctcggctgcg ccctgcccca tcctgctggg accatggtct gctgcggccc       420
     gggacggatg ctgctaggat gggccgggtt gctagtcctg gctgctctct gcctgctcca       480
     ggtgcccgga gctcaggctg cagcctgtga gcctgtccgc atcccgctgt gcaagtccct       540
     tccctggaac atgaccaaga tgcccaacca cctgcaccac agcacccagg ctaacgccat       600
     cctggccatg gaacagttcg aagggctgct gggcacccac tgcagcccgg atcttctctt       660
     cttcctctgt gcaatgtacg cacccatttg caccatcgac ttccagcacg agcccatcaa       720
     gccctgcaag tctgtgtgtg agcgcgcccg acagggctgc gagcccattc tcatcaagta       780
     ccgccactcg tggccggaaa gcttggcctg cgacgagctg ccggtgtacg accgcggcgt       840
     gtgcatctct cctgaggcca tcgtcaccgc ggacggagcg gattttccta tggattcaag       900
     tactggacac tgcagagggg caagcagcga acgttgcaaa tgtaagcctg tcagagctac       960
     acagaagacc tatttccgga acaattacaa ctatgtcatc cgggctaaag ttaaagaggt      1020
     aaagatgaaa tgtcatgatg tgaccgccgt tgtggaagtg aaggaaattc taaaggcatc      1080
     actggtaaac attccaaggg acaccgtcaa tctttatacc acctctggct gcctctgccc      1140
     tccacttact gtcaatgagg aatatgtcat catgggctat gaagacgagg aacgttccag      1200
     gttactcttg gtagaaggct ctatagctga gaagtggaag gatcggcttg gtaagaaagt      1260
     caagcgctgg gatatgaaac tccgacacct tggactgggt aaaactgatg ctagcgattc      1320
     cactcagaat cagaagtctg gcaggaactc taatccccgg ccagtacgaa gctaaatcct      1380
     gaaatgtaaa aggccacacc cacggactcc cttctaagac tggcgctgct ggactaacaa      1440
     aggaaaactg cacagttgtg ctcgtgaccg attgtttacc agacaccgcg tggctacaga      1500
     agttactgct ggtccccttt ctcctgcttc ttaatggcct ggggttagat cctttaatat      1560
     gttatatatt ttatttcatc aatcacgtgg gaactgttct tttgcaacca gaatagtaaa      1620
     ttaaatatgt tgatgctaag gtttctgtac tggactccct gggtttaatt tggtgttctg      1680
     taccccgatt gagaatgcaa tgtttcatgt aaagagagaa tcctggtcat atctcaagaa      1740
     ctagatattg ctgtaagaca gcctctgctg ctgcgcttat agtcttgtgt ttgtatgcct      1800
     ttggccattt ccctcatgct gtgaaagtta tacatgttta taaaggtaga acggcatttt      1860
     gaaatcagac actgcacaag cagagtagcc caacaccagg aagcatttat gaggaaacgc      1920
     cacacagcgt gacttatttt caagattggc aggcagcaaa ataaatagtg ttgggagcca      1980
     agaaaagaat attttgcctg gttaaggggc acactggaat cagtagccct tgagccatta      2040
     acagcagtgt tcttctggca acgtttttga tttgttcata aatgtattca cgagcattag      2100
     agatgaactt ataactagac atctgttgtt atcactatag ctctgcttcc ttctaaatca      2160
     aacccattgt tggatgctcc ctctccattc ataaataaat ttggcttgct gtattggcca      2220
     ggaaaagaaa gtattaaagt atgcatgcat gtgcaccagg gtgttattta acagaggtat      2280
     gtaactctat aaaagactat aatttacagg acactgaaat gtgcacattt gtttactttt      2340
     tttcttcctt ttgctttggg cttgtgattt tggtttttgg tgtgtttatg cctgtatttt      2400
     ggggggtggg taggtttaac ccattgcaca ttcaagttga actagattag agtagactag      2460
     gctcattggc ctagacatta tgatttgaat ttgtgttgtt taatgctcca tcaagatgtc      2520
     taataaaagg aatatggttg tcagcagaga cgacaacaac aacaaaaatg tttttcttat      2580
     gtgtgctgca gtgagacccc aacaacccat ggggggggga ccccacgatg ccttttcttc      2640
     cttccctgca gcagggatgt gcccatcacc tgaaagtctc attccctgaa atttacacat      2700
     gtggtagtag taggtccaga ttcctaagct acagtgtgct gaaaaataaa acaggtatga      2760
     agcaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa            2814
//