spacer

EBI Dbfetch

ID   BC016670; SV 1; linear; mRNA; STD; MUS; 1589 BP.
XX
AC   BC016670;
XX
DT   13-NOV-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus argininosuccinate lyase, mRNA (cDNA clone MGC:6507
DE   IMAGE:2648753), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1589
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1589
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 739c2790adc7e07bc5a23be59fb37b4b.
DR   Ensembl-Gn; ENSMUSG00000025533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159619; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161094; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Chu-Xia Deng Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: f Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 19526985.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1589
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="129,C57BL/6J,FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam3"
FT                   /clone="MGC:6507 IMAGE:2648753"
FT                   /tissue_type="Mammary tumor. Brca1-/fl; MMTV-Cre model. 10
FT                   months old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1589
FT                   /gene="Asl"
FT   CDS             82..1476
FT                   /codon_start=1
FT                   /gene="Asl"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="GOA:Q91YI0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="MGI:MGI:88084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YI0"
FT                   /protein_id="AAH16670.1"
FT                   /translation="MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAY
FT                   SRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAA
FT                   GKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQR
FT                   AQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNF
FT                   GAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGS
FT                   SLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMI
FT                   AVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAE
FT                   TKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRAL
FT                   LQAQEP"
FT   misc_difference 1530..1589
FT                   /gene="Asl"
FT                   /note="polyA tail: 60 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1589 BP; 443 A; 413 C; 451 G; 282 T; 0 other;
     cgccatccgg accagaaaaa gccaggagag accagaagat tcgtaagaca gaagctccag        60
     gaggaggagg aaccgcccaa catggcatca gagagcggga agctatgggg tggccggttt       120
     gtgggtgctg tcgaccccat catggagaag ttcaactcat ctatctccta tgaccggcat       180
     ctgtggaatg tggatgtgca ggggagcaag gcctacagca ggggcctgga gaaggcgggg       240
     cttctcacca aagccgagat gcagcagata ctgcaagggt tggacaaggt tgctgaagag       300
     tgggcccaag gcaccttcaa attacatcct aatgatgaag acatccacac agccaacgag       360
     cggcgcctga aggaactcat cggtgaagct gcagggaagc tacacacagg acgaagtcgc       420
     aacgaccagg tggtcacgga cctcaggctg tggatgaggc agacctgctc aaaactctcc       480
     gccctcctcc gggtgctcat tggaaccatg gtcgaccggg cagaggcgga acgtgatgtc       540
     ctcttcccag ggtacacaca cttgcagaga gctcagccca ttcgctggag ccactggatc       600
     ctgagccacg ctgttgcgct gacacgagat tcagagagac tcttggaggt gcagaagcgg       660
     atcaatgtct tgccactggg gagtggggcc attgcaggca accctctggg tgtggaccgg       720
     gagctactcc gtgcagaact gaactttggg gccatcactc tcaacagcat ggatgccacc       780
     agtgagagag actttgtggc tgagttcctg ttttgggctt ctctgtgtat gacccacctc       840
     agcaggatgg cagaggacct aattctctat ggtaccaagg aattcagctt tgtgcaactc       900
     tcagatgcct acagcaccgg aagcagcttg atgccccaga agaaaaaccc agacagcctg       960
     gagctgatcc ggagcaaggc gggccgagtg tttggacggt gtgccggact cctgatgacc      1020
     ctcaagggac ttccaagcac ctacaacaag gacttacagg aagacaagga ggctgtgttt      1080
     gaagtgtctg acaccatgat agctgtcctc caagtggcca ctggagtcat ctctacattg      1140
     cagattcatc gtgagaacat gaaacaggcg ctcagccctg acatgctggc cacggacctc      1200
     gcctactacc tggtccgcaa agggatgcca ttccgccagg cccacgaggc ctcagggaaa      1260
     gctgtgttca tggcagagac taaaggagtg gctctcaacc tgctgtcgct acaggagctg      1320
     cagaccatca gtcccctgtt ctcaggtgat gtgagtcacg tgtgggacta cagtcacagc      1380
     gtggaacagt acagtgcctt gggtggcaca gcgaaatcca gtgtcgaatg gcagatcagg      1440
     caggtgcggg ccctactgca agcccaggag ccctagatcc cgcccaccca aagctgctcc      1500
     ccaataaagt ggagccctga agaaaccgaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1560
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                                        1589
//


spacer
spacer