Dbfetch

ID   BC016585; SV 1; linear; mRNA; STD; MUS; 2389 BP.
XX
AC   BC016585;
XX
DT   13-NOV-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus UDP-N-acetyl-alpha-D-galactosamine:polypeptide
DE   N-acetylgalactosaminyltransferase 10, mRNA (cDNA clone MGC:27969
DE   IMAGE:3595220), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2389
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2389
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6a6f9dbe55cfe588f9ee05435ba65435.
DR   Ensembl-Gn; ENSMUSG00000020520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066987; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 35 Row: m Column: 12.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2389
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:27969 IMAGE:3595220"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2389
FT                   /gene="Galnt10"
FT                   /note="synonyms: GalNAc-T9, ppGaNTase, Galnt9, GalNAc-T10"
FT   CDS             22..1041
FT                   /codon_start=1
FT                   /gene="Galnt10"
FT                   /product="Galnt10 protein"
FT                   /db_xref="GOA:Q6P9S7"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1890480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P9S7"
FT                   /protein_id="AAH16585.1"
FT                   /translation="MIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPS
FT                   DPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRV
FT                   GHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLR
FT                   VSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCTDTKLGTLGSPLRLE
FT                   TCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQ
FT                   LWKYRKDKTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFNKN"
FT   misc_difference 135
FT                   /gene="Galnt10"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 228
FT                   /gene="Galnt10"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 234
FT                   /gene="Galnt10"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 594
FT                   /gene="Galnt10"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 603
FT                   /gene="Galnt10"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 879
FT                   /gene="Galnt10"
FT                   /note="'A' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 942
FT                   /gene="Galnt10"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1072
FT                   /gene="Galnt10"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1313
FT                   /gene="Galnt10"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1450
FT                   /gene="Galnt10"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1658
FT                   /gene="Galnt10"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1660
FT                   /gene="Galnt10"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1695
FT                   /gene="Galnt10"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1969..1970
FT                   /gene="Galnt10"
FT                   /note="in the mouse genome : CT."
FT   misc_difference 2014
FT                   /gene="Galnt10"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2056
FT                   /gene="Galnt10"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2081
FT                   /gene="Galnt10"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2128
FT                   /gene="Galnt10"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2341
FT                   /gene="Galnt10"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2378..2389
FT                   /gene="Galnt10"
FT                   /note="polyA tail: 12 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2389 BP; 549 A; 655 C; 692 G; 493 T; 0 other;
     cggaagacca tcgtgtgccc aatgatcgat gtcatcgacc acgatgactt ccggtatgag        60
     actcaggctg gggacgccat gcgtggtgcc ttcgactggg aaatgtatta caaacggatc       120
     ccaatccctc cagaactgca gaaggctgac cccagtgacc catttgagtc tcccgtgatg       180
     gctggagggt tgttcgctgt ggaccggaaa tggttctggg agttgggcgg ctacgaccct       240
     ggcttggaga tctggggagg agagcagtat gagatctcct tcaaggtgtg gatgtgtggg       300
     ggccgcatgg aggacatccc ctgctccaga gtgggccaca tctacaggaa gtatgtgccc       360
     tacaaggtcc ctgccggagt cagcctggcc cggaacctga agcgagtggc agaggtatgg       420
     atggatgaat acgcagaata catctaccag cgcaggccgg agtaccgcca cctctcagct       480
     ggagatgtcg tggcccagaa aaagctccga gtctccctca actgtaagag cttcaagtgg       540
     tttatgacca aaattgcctg ggacctgccc aagttctacc cacccgtgga acccccggct       600
     gcagcatggg gggagattcg caatgtgggc acaggactgt gcacagacac gaagcttggc       660
     acactgggct ccccactgag gctcgagacc tgcatccggg gccgaggcga ggctgcttgg       720
     aacagtatgc aggtctttac cttcacctgg cgggaggaca tccggcctgg agaccctcag       780
     cacaccaaga agttttgctt cgacgctgtc tcccacacca gcccagtcac cctctacgac       840
     tgccacagca tgaagggcaa ccagctgtgg aaataccgaa aggacaagac gctgtaccac       900
     cctgtgagcg gcagctgcat ggactgcagc gagagtgacc atagggtctt catgaacacc       960
     tgcaatccct cctccctcac ccagcagtgg ctctttgaac acaccaactc gacggtctta      1020
     gagaatttca acaagaactg agtccttaga ccttgacaaa cccctcaggt tgctgtggag      1080
     ctcataaacc ttcctcctgt gggagaagag gcatcggtgg gcaccaaggt gctgggttct      1140
     tgaaggactg acatggtggg gccacgggga gaacagacca taccaatggc tctccaagaa      1200
     ggcggagcct gctcacatca tagcagagct caccagcctg tcagcatgtt ccctaagtgt      1260
     taggaatcgc ctgggcagcc ttgagccatg aggttgccct tgcagacagg acggtgccct      1320
     agaaaggaag gtggtatcgg ccttgggaca gcttaaacct gtgtgccagc tgctggcaag      1380
     gaagtctgcc tgttcttgag ggaactgcta gaattgccca gcttctgtgt tggtccaggg      1440
     caatgagagt ccattgggac ttccgagtgc tccatagcta gcactggcca gcaaccaggc      1500
     gaggggcccc ttcctctgca gccagatgta aaggatgtct cccctggctc tctgggtatt      1560
     tcagatgccc gttctagttt cagggctacc tgggcaccag gtcgtcaggg ctagttcagc      1620
     cggctaagta gacctccaga ccgaacagct cccagccgac gcttccaaag ccctttctcc      1680
     gtgcttttcc ttggtggctc cctgccttgg agaggaaccg gtgctgtgag ggatcacctc      1740
     cagagtctcc tggggggtgg cttcccccag ataatgactg ctgtggttcc aacctcacag      1800
     aaccctggag tttctggaaa gttctgtggt tctgttgaaa gcatagatga gccatggcac      1860
     gtgtgggcat ataacgcaag cagccaggtg tcaggcaacc cctgacccaa gcagaggcgg      1920
     tagggcacca gaagcttcgg tccaacccaa tgccgtcaca gccacagctg cgtgaggtgt      1980
     gaggacatca cctttagccc catgtctcaa acaagaactc accctccaag gagctggtca      2040
     cttgccagtg aagtatctga gacatggtcc tgaggccaga actctgcctt agagatgctg      2100
     ggatcggggt catcgggtcc ccaggctggt cgggttggtg ctgtagaacc acctccacgt      2160
     agcccctgtg ctgtcacagc tcacttgtgg atttctagtg cccttttcca tatgagcact      2220
     ctgtctgaca agtggccggc tgggaaggag tcaaaaaggg gagtgggtgg gtgtccagaa      2280
     tccagcaggg atgcgtgttg cagccaaggg gagttgagtc ctcagagagc aatgcggcct      2340
     cgtttcaata aaaaccgtgc cttttacaaa gagaaaaaaa aaaaaaaaa                  2389
//