Dbfetch

ID   BC016110; SV 1; linear; mRNA; STD; MUS; 2134 BP.
XX
AC   BC016110;
XX
DT   26-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus limb region 1, mRNA (cDNA clone MGC:28737 IMAGE:4481088),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2134
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2134
RA   Strausberg R.;
RT   ;
RL   Submitted (22-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 8d55a4294816cd4d52ff018928caaf9d.
DR   Ensembl-Gn; ENSMUSG00000010721; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029374; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029340; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029291; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029351; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029072; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029804; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028483; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029040; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029189; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029147; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029274; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029176; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029838; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028207; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028563; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000055195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198105; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070594; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070672; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070585; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070243; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070778; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070320; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070232; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070395; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070258; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070247; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069401; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 38 Row: a Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2134
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:28737 IMAGE:4481088"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2134
FT                   /gene="Lmbr1"
FT   CDS             39..1430
FT                   /codon_start=1
FT                   /product="Lmbr1 protein"
FT                   /db_xref="GOA:Q9JIT0"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1861746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JIT0"
FT                   /protein_id="AAH16110.1"
FT                   /translation="MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRK
FT                   SDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSL
FT                   IHEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYL
FT                   PYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQR
FT                   RLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLIETSIS
FT                   VLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFY
FT                   SLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLG
FT                   NFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTKPSANG
FT                   HQKAL"
XX
SQ   Sequence 2134 BP; 555 A; 453 C; 489 G; 637 T; 0 other;
     gcagacgcgg gcggccctgc ggtgggtatg aaaggaggat ggaagggcag gacgaggtgt        60
     cggcgcggga gcagcacttc cacagccaag tgcgagagtc cacgatatgt tttcttctct       120
     ttgccattct ctacatcgtt tcctacttca tcattataag atacaagaga aaatccgatg       180
     aacaagaaga tgaggatgct gtagtcaaca ggatatcgtt gtttctgagc accttcactc       240
     tagccgtgtc agctggcgcg gttttgcttt tacccttctc aatcatcagc aatgagatcc       300
     tgcttgcttt tcctcacaac tactatattc agtggctgaa tggctccctc atccacgaag       360
     gttttgcagg cctgaaaaag ggaatccgag cccgcatttt ggaaactctg gttatgctgc       420
     tgcttcttgc gttgctgatt cttgggatgg tgtgggtggc ttccgccctg attgacagtg       480
     atgctgccag tatggagtct ttatatgatc tctgggaatt ctacttgccc tatttgtatt       540
     cttgcatttc gctgatggga tgcttgctgc ttctcttgtg tactccagtt ggcctgtccc       600
     gtatgttcac agtcatgggt cagttgctgg tgaagccagc gattcttgaa gacctggatg       660
     aacaaattta tatgattact ctagaagaag aagcactcca gagaagacta catgggctat       720
     cttcatcggt ggagtacaat gtaatggaat tggagcaaga acttgagaat gtaaagatcc       780
     ttaagacaaa attagagagg aggaaaaagg cttcagcttg ggagagaaat ttggtgtatc       840
     ctgctgttat ggttctcctt cttattgaaa catccatttc agtcctcctg gtggcgtgca       900
     atattctttg cctgctggtt gatgagactg caatgccaaa gggaacaagg ggccccggca       960
     taggaagtgc ctctctttcc acttttggct ttgtgggagc tgcacttgaa atcattctga      1020
     ttttctatct catggtgtct tctgttgttg gtttctatag cctcagattt tttggaaact      1080
     ttacacccaa gaaggatgac acaactatga caaagatcat tgggaattgt gtgtcaatct      1140
     tagtcttgag ctctgctttg cctgtgatgt ccagaacact gggaatcact agattcgatc      1200
     tacttggaga ctttggaaga tttaattggc tgggaaattt ctatattgta ttatcctaca      1260
     atttactctt cgccatcatg acaacattgt gtttgatcag aaaattcaca tcagcagtac      1320
     gagaagaact tttcaaggcc ctaggacttc acaaacttca cttgtcagat acctcaaggg      1380
     attcagaaac tacaaagcct tctgcaaatg ggcatcagaa agcactgtga gacctgactg      1440
     cctcagtagc actctacagc aagtcccgac aactgattca tgacattccc atagacagtg      1500
     ttcattctgg tgggtctgga cccagctgac agtgcccttt cgcataagca cttacaactt      1560
     agcactagtc atctgtgtct cctgggagtt ttctgattgg ccggatatga cagcttttgg      1620
     ttaaaccctg agtcttgaga ctgaggaaaa gctgtgtgtc tatagcagga actacctgga      1680
     tgagaggtga agactcggac gcccttaggc ttttgcttta caccatgaga agcttggttc      1740
     tgcaggcaga agcctgcctg aaagtcatct ggtgccccaa agcattttca caaggtcctg      1800
     gaaactgttg tacaagtaac aaactacatt tttatttaaa aaaccaaaag cagattttct      1860
     gattcatctt acagaatctt cattagactt tgagccagtg gaacatacta gattctttaa      1920
     acacctgagc cttggtgggc agccccagga ctattttttt gtggtaagct gcagtatgaa      1980
     gcacatgcga ttgtagattt ggacagtgtg tgtacctgat aatacttttc acagcacagt      2040
     gccagtgttg tacacacctt agactttgcc ttataggctg tatgtacatt cattttttaa      2100
     aacctttttt tcaaaaacta aaaaaaaaaa aaaa                                  2134
//