spacer

EBI Dbfetch

ID   BC015825; SV 1; linear; mRNA; STD; MUS; 1472 BP.
XX
AC   BC015825;
XX
DT   23-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus alpha-methylacyl-CoA racemase, mRNA (cDNA clone MGC:13903
DE   IMAGE:3980103), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1472
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1472
RA   Strausberg R.;
RT   ;
RL   Submitted (15-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 0bd8ee85b133b45c6f12e26ca6ff421c.
DR   Ensembl-Gn; ENSMUSG00000022244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070877; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: c Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678765.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1472
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:13903 IMAGE:3980103"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1472
FT                   /gene="Amacr"
FT   CDS             46..1128
FT                   /codon_start=1
FT                   /gene="Amacr"
FT                   /product="Amacr protein"
FT                   /db_xref="GOA:Q91YQ8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="MGI:MGI:1098273"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YQ8"
FT                   /protein_id="AAH15825.1"
FT                   /translation="MVLADFGAEVVRVNRLGSTGENFLARGKRSLALDLKRSQGVTVLR
FT                   RMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYARLSGFGQSGIFSKVAGHDINY
FT                   LALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGIVLALFERTRSGRGQVIDSSMV
FT                   EGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTYKTADGEFMAVGAIEPQFYALL
FT                   LKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFEEA
FT                   LHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAKRDPSVGEHTVEVLREYGFSQE
FT                   EILQLHSDRIVESDKLKANL"
FT   misc_feature    136..705
FT                   /gene="Amacr"
FT                   /note="CoA_transf_3; Region: CoA-transferase family III.
FT                   CoA-transferases are found in organisms from all lines of
FT                   descent. Most of these enzymes belong to two well-known
FT                   enzyme families, but recent work on unusual biochemical
FT                   pathways of anaerobic bacteria has revealed the existence
FT                   of a third family of CoA-transferases. The members of this
FT                   enzyme family differ in sequence and reaction mechanism
FT                   from CoA-transferases of the other families. Currently
FT                   known enzymes of the new family are a formyl-CoA: oxalate
FT                   CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate
FT                   CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate
FT                   CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine
FT                   CoA-transferase. In addition, a large number of proteins of
FT                   unknown or differently annotated function from Bacteria,
FT                   Archaea and Eukarya apparently belong to this enzyme
FT                   family. Properties and reaction mechanisms of the
FT                   CoA-transferases of family III are described and compared
FT                   to those of the previously known CoA-transferases"
XX
SQ   Sequence 1472 BP; 368 A; 371 C; 396 G; 337 T; 0 other;
     ccacgcgtcc ggctggcagg cctggccccg gggccgttct gcggaatggt cctggcggac        60
     ttcggcgccg aggtggtgcg cgtgaaccgg ctgggctcca cgggcgagaa ttttctggcc       120
     cgaggcaagc gctcgctagc gctggacctg aagcgctctc agggagtcac ggtgttgcgg       180
     cgcatgtgcg cacgcgcgga cgtgttgctg gagcccttcc gctgcggtgt catggagaaa       240
     ctccagcttg ggccagagac tctactgcag gacaatccaa agctcatcta tgccaggctg       300
     agcggatttg gccaatcggg aattttctcc aaagtagctg gccatgacat caactatttg       360
     gctttatcag gcgttctgtc aaagattggc agaagcggtg agaaccccta cccaccgctg       420
     aatctcctgg ctgactttgg cggtggaggc ctcatgtgca cactgggcat tgtgctggct       480
     ctctttgaac gcacacgctc tggccgaggg caggtcatcg attcaagcat ggtggaaggg       540
     actgcatact taagttcttt cctgtggaaa acccagccca tgggtctgtg gaaacagcct       600
     cgaggacaaa acatcttaga tggcggtgca cctttctaca caacctacaa gacggcagac       660
     ggggagttca tggctgtagg tgccatagaa ccccagttct atgcactgct gcttaaagga       720
     cttggactcg agtctgagga actcccctcc cagatgagct cagcagattg gccagagatg       780
     aagaagaaat ttgcagatgt gtttgcaaag aagactaagg cagaatggtg ccagatcttt       840
     gacgggacag atgcgtgtgt gaccccagtg ctgacgtttg aggaggccct ccaccaccag       900
     cacaacagag aacgggcctc cttcatcact gatggggagc agctcccgag cccccgccct       960
     gcacctctgc tttccagaac tcctgccgtc ccatctgcca aaagggaccc ttctgtaggg      1020
     gagcacaccg tagaagtgct tagagagtat ggattcagtc aggaagagat ccttcagctg      1080
     cactcagata gaatcgttga aagtgataag ctaaaagcca atctctgact caggcttata      1140
     gctcaagaga atctgaaggc tgcatctcca ctggggaggg atgcccacaa ttgtgtgtat      1200
     ggaaatgtgg atgaacagca atgaagtcat ccaaatatcc caatcacgat ccaacgaaag      1260
     gctggttaca ggataacgat tgcgccctta cgctgcttat cagagcctct gattgaggaa      1320
     aatttgtgtg tgtgtactga tagtaacttg tggcagcttt ctgcctttca gttcccttgg      1380
     tgaagtgtat ccatttatta aaaccctttt ataaatacaa ctctgatcat atattaaata      1440
     aactattata actttaaaaa aaaaaaaaaa aa                                    1472
//


spacer
spacer