spacer

EBI Dbfetch

ID   BC015632; SV 2; linear; mRNA; STD; HUM; 2713 BP.
XX
AC   BC015632;
XX
DT   22-JAN-2002 (Rel. 70, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens chromosome 7 open reading frame 27, mRNA (cDNA clone MGC:22916
DE   IMAGE:3839985), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2713
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2713
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
XX
CC   On Dec 19, 2003 this sequence version replaced gi:18182862.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 33 Row: a Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 52851444.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2713
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_21"
FT                   /clone="MGC:22916 IMAGE:3839985"
FT                   /tissue_type="Placenta, choriocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..2713
FT                   /gene="C7orf27"
FT                   /note="synonym: MGC22916"
FT   CDS             43..2508
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /product="chromosome 7 open reading frame 27"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="H-InvDB:HIT000037229.16"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="AAH15632.2"
FT                   /translation="MDPECAQLLPALCAVLVDPGQPVADDTCLEKLLDWFKTVTEGESS
FT                   VVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFG
FT                   EPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASA
FT                   ASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLT
FT                   TTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWE
FT                   TVARALSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGL
FT                   LDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLR
FT                   LCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLE
FT                   SPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVR
FT                   DSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQG
FT                   LHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFV
FT                   ATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRA
FT                   LCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLP
FT                   RWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGF
FT                   LQGDEADCY"
FT   misc_difference 100
FT                   /gene="C7orf27"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'G' in cDNA, 'R' in the human genome."
FT   misc_difference 2701..2713
FT                   /gene="C7orf27"
FT                   /note="polyA tail: 13 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 2713 BP; 442 A; 925 C; 859 G; 487 T; 0 other;
     gttgcggcgg aggacgcaac cgagcgggcc tgcggcctca ccatggaccc agaatgcgcc        60
     cagctgctcc cggctctctg tgctgttctg gtagatcccg ggcagccggt ggcagatgac       120
     acctgtttgg agaagctcct ggactggttt aaaacggtca ctgaaggaga gtccagtgtc       180
     gtgctgctgc aggagcaccc ctgcctggtg gagctgctgt cccatgtgct gaaagtccag       240
     gacctgagtt ctggggtcct ctccttctca ctgcgcctgg caggaacctt cgcagcccag       300
     gaaaactgct tccagtatct tcagcagggg gagttactac cagggctctt tggggagcca       360
     ggacccctcg gccgagcaac ctgggccgtc cccaccgtgc gcagcggctg gatccagggc       420
     ctgcgctccc tggcacagca ccccagcgcc ctgcgcttcc tggccgacca tggtgcggtc       480
     gacaccatct tctccctgca gggagactcc agcctgtttg tggcctcggc ggccagtcag       540
     ctcctggtgc acgtcctggc tttgtccatg cgaggtggag ccgaggggca gccctgcctg       600
     ccggggggtg actggcccgc gtgtgcccag aagatcatgg atcacgttga agagtccttg       660
     tgctccgcgg ccacccccaa ggtcactcag gccctgaacg tcctgaccac gaccttcggg       720
     cgctgccaga gcccctggac ggaagccctg tgggtgcggc tgagtccccg cgtggcctgt       780
     ctgctggaga gagaccccat ccccgccgca cactcgttcg tggacctgct tctctgtgtg       840
     gctcgttctc ccgtgttcag ttcttccgac ggcagcctgt gggagacagt ggcgcgggct       900
     ctgagctgcc tgggtcccac ccacatggga cccctggctt tggggatcct gaagctcgag       960
     cactgtccac aggcactgag gacccaggcc ttccaggtcc ttctccagcc cctggcctgt      1020
     gtcctgaagg ccacggttca ggcccccgga cccccaggct tgctggacgg gacggcagac      1080
     gatgccacga cggtggacac actcctggcc tccaagtcgt cctgcgccgg cctcctgtgc      1140
     cgcaccctgg ctcacctgga ggagctgcag ccgctgcccc agcgcccttc accgtggccc      1200
     caggcgtctc tactgggggc tacagtgact gtcctgcggc tctgtgacgg ctcggctgcc      1260
     cctgcctcca gtgtgggggg ccacctctgt gggaccctgg cgggctgcgt ccgggtccag      1320
     cgagcagccc tcgacttcct ggggacgctg tcacagggga caggccccca ggagctggtg      1380
     acgcaggcgc ttgctgtcct cctggagtgc ctcgagagcc ccggctccag ccccacggtt      1440
     ctgaagaagg ccttccaggc cacgctcagg tggctcctga gctcacccaa gacccccggc      1500
     tgctctgatc tcggccccct catcccgcag ttcctcagag agctgttccc tgtgctgcag      1560
     aaacgcctgt gccacccctg ctgggaggtg agggactccg ccctcgagtt cctgacccag      1620
     ctgagcaggc actggggagg acaggctgac ttcagatgcg cactcttggc ttcagaggtg      1680
     cctcagctgg ccctgcagct cctccaggac cctgagagtt atgtccgagc gagtgcagtg      1740
     accgccatgg ggcagctgtc cagccagggc ctgcacgccc ccaccagccc tgagcatgca      1800
     gaggcccggc agagcctgtt cctggagctc ctgcacatcc tctccgtaga ctcggagggc      1860
     ttcccacggc gggcggtcat gcaagtcttc actgagtggc tgcgggacgg ccacgccgac      1920
     gcggcccagg acacggagca gttcgtggcc actgtgctgc aggcggcgag ccgagacctg      1980
     gactgggagg tccgcgccca gggcctggag ctggccctcg tgttcctggg ccagactttg      2040
     gggccgccgc gtacccactg cccctatgcc gtggccctac ccgaggtggc cccagcccag      2100
     ccactcaccg aggcactgag ggctctctgc cacgtggggc tctttgactt cgccttttgt      2160
     gccttgtttg actgcgaccg ccctgtggcg cagaagtctt gtgacctcct tctcttcctg      2220
     agggacaaga ttgcttccta cagcagcctg cgggaggcca ggggcagccc caacactgcc      2280
     tccgcagagg ccaccctgcc gaggtggcgg gcgggtgagc aggcccagcc cccaggggac      2340
     caggagcctg aggctgtgct ggccatgctc aggtccctag acctggaggg cctgcggagc      2400
     acgctggccg agagcagcga ccacgtggaa aagagtcccc agtccctcct gcaggacatg      2460
     ctggccacgg gaggcttcct gcagggggac gaggccgact gctactgagc agaaccagag      2520
     tctgccactg gggctcagga ccaagggagg cagcaccatg tccttctgtg ggacactgcc      2580
     agccccaggg ctccagccca gcccggtgga tcctctgggg aagccaggac caggagagaa      2640
     gcaaggtcaa gaaatcccac agtttgatgt attaaagaaa tgacttattt ctactcaaaa      2700
     aaaaaaaaaa aaa                                                         2713
//


spacer
spacer