spacer

EBI Dbfetch

ID   BC015299; SV 1; linear; mRNA; STD; MUS; 3414 BP.
XX
AC   BC015299;
XX
DT   08-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus adenylate cyclase 4, mRNA (cDNA clone MGC:19190
DE   IMAGE:4236007), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3414
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3414
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b8cd42f1fca3a71bffc5c4ce7ee5696f.
DR   Ensembl-Gn; ENSMUSG00000022220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002398; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170223; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 25 Row: m Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 17978249.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3414
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:19190 IMAGE:4236007"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3414
FT                   /gene="Adcy4"
FT                   /note="synonym: mKIAA4004"
FT   CDS             113..3346
FT                   /codon_start=1
FT                   /gene="Adcy4"
FT                   /product="adenylate cyclase 4"
FT                   /db_xref="GOA:Q91WF3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR009398"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:99674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91WF3"
FT                   /protein_id="AAH15299.1"
FT                   /translation="MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCALVALP
FT                   AVAWASGRELTSDPSFLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWVALLALG
FT                   YGFLFTGGVVSAWDQVSFFLFIIFTVYAMLPLGMRDAAAAGVISSLSHLLVLGLYLGWQ
FT                   PESQRALLPQLAANAVLFLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKH
FT                   QEHLLLSILPAYLAREMKAEIMARLQAGQRSRPENTNNFHSLYVKRHQGVSVLYADIVG
FT                   FTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAIN
FT                   CVRMGLDMCRAIRKLRVATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHM
FT                   EAGGVPGRVHITGATLALLAGAYAVERADTEHRDPYLRELGEPTYLVIDPRAEEEDEKG
FT                   TAKGLLSSLEGHTMRPSLLMTRYLESWGAAKPFAHLSHLDSPVSTSTPLPEKAFSPQWS
FT                   LDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLS
FT                   ALPAFKYYAACTFLVFLSNFTIQMLVTTRPPALIITYSITFLLFFLLLFVCFSEHLTKC
FT                   VQKGPKMLHWLPALSVLVATRPGFRVALGTATILLVFTMAIASLLFLPVSSDCLFLASN
FT                   VSSVTFNASWEMPGSLPLISIPLISIPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWL
FT                   VASCSLFLHSHAWLSDCLIARLYQSPSDSRPGVLKEPKLMGAIYFFIFFFTLLVLARQN
FT                   EYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSY
FT                   ECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIG
FT                   STYMAATGLNATSGQDTQQDSERSCSHLGTMVEFAVALGSKLGVINKHSFNNFRLRVGL
FT                   NHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYSR
FT                   GSIKVKGKGELCTYFLNTDLTRTGSPSAS"
FT   misc_difference 3396..3414
FT                   /gene="Adcy4"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3414 BP; 727 A; 990 C; 920 G; 777 T; 0 other;
     gtgagtagta gccatcccac ccaggttccc tcctggagcc tagctttgct gagagaactt        60
     ctggagcttg acccaaagcg ggcaggggct ccgggctggg gcggggaaga ccatggcccg       120
     cctcttcagt ccccggcctc ctcccagcga agatctcttc tacgaaactt actacagcct       180
     gagccaacag tacccactgc tgatactgct tttggtcatt gtgctctgcg cgctggtggc       240
     actgcccgcc gtcgcctggg ccagcggcag ggagctgacc tcagacccaa gcttcctgac       300
     aactgtgctg tgtgctttgg gtggcttctc tctgctattg gggcttgctt cccgggagca       360
     gcaactgcag cgatggacac gacctctttc tggtctcata tgggttgcat tactggctct       420
     gggctatgga tttctgttca ctgggggtgt ggtgagcgcc tgggaccagg tgtctttttt       480
     cctcttcatc atcttcaccg tgtacgccat gctgcccttg ggcatgcggg atgctgctgc       540
     tgcgggagtc atctcatccc tctcgcacct gctggtcctt ggactgtatc ttgggtggca       600
     gcctgagtca cagagagctc tgctaccaca gttggcagca aacgcggtat tgttcctgtg       660
     tgggaacgtg gtgggagcgt accacaaggc cctgatggag cgagcattgc gggccacgtt       720
     ccgggaggct cttagctctc tgcactcacg ccggaggctg gacactgaga aaaagcacca       780
     ggagcacctc ctcttgtcta tccttcctgc ctacctggcc cgagagatga aagcagagat       840
     catggcccgg ctgcaggctg gacagcgctc acggccagag aacacaaaca actttcacag       900
     cctgtatgtc aagaggcacc aaggagtgag tgtgctgtat gctgacatcg tgggcttcac       960
     gcggctggcc agcgagtgtt ccccgaagga gctggtgctc atgctgaatg agctctttgg      1020
     caagttcgac caaattgcca aggagcacga atgcatgcgg atcaagatcc tgggagactg      1080
     ttactactgt gtctccgggc tgcccctctc gctgcctgac cacgctatca attgtgtgcg      1140
     catggggctg gacatgtgcc gggccatcag gaaacttcgg gtagccaccg gtgtggatat      1200
     caacatgcgt gtgggcgtgc actcgggcag cgttctctgt ggagtcattg ggctacagaa      1260
     gtggcagtat gatgtctggt cccatgatgt cacattggcc aaccatatgg aagcaggcgg      1320
     tgtaccagga cgagtgcaca tcacaggggc cacgctggcc ctgctagcag gagcttatgc      1380
     tgtggagagg gcagacacgg aacaccgaga cccatacctt cgggagctag gagaacctac      1440
     atacctggtc attgatcctc gggctgagga ggaagacgag aagggcaccg caaaaggatt      1500
     gctgtcttct ctggaggggc acacgatgcg tccgtcacta ctgatgactc gctatctgga      1560
     gtcttggggt gcagccaagc ctttcgccca cctaagccac cttgacagtc ccgtgtccac      1620
     ctccactcca ctcccggaga aagccttcag cccccagtgg agcctggacc ggagtcgcac      1680
     cccccgggga ctagatgatg aactggacac tggtgatgct aagttcttcc aggtcatcga      1740
     acaactcaac tctcagaaac agtggaagca gtcgaaggac ttcaacctcc tgacgctgta      1800
     cttcagagag aaggagatgg agaaacagta tcggctctct gcactccccg ccttcaaata      1860
     ctacgcagcc tgcaccttcc tggtttttct gtccaacttc actatccaaa tgctggtgac      1920
     aaccaggccc ccagctctga tcatcaccta cagcatcacc ttccttctct tctttctcct      1980
     cctcttcgtc tgcttctcag agcacctgac gaagtgtgtc cagaaaggtc ccaagatgtt      2040
     gcactggctg cctgcactgt ctgtcctggt ggccacacgg ccaggatttc gagtagccct      2100
     gggtacggcc accatcctcc tggtattcac tatggccatc gccagcctgc tcttcttacc      2160
     agtgtcatca gactgccttt tcctggcttc caatgtgtca tctgtgactt tcaatgcttc      2220
     ctgggagatg ccaggatccc tgcccctcat cagcatcccc ctcatcagca tcccatactc      2280
     catgcattgc tgcgtgttgg gtttcctctc ctgctccctt tttctgcaca tgagcttcga      2340
     actgaagctg ctcctacttc tgctgtggct ggtggcatct tgttccctat ttctgcattc      2400
     ccacgcctgg ctgtctgact gcctcattgc ccgcctttat caaagccctt cggactccag      2460
     accaggggta ctgaaggaac ccaagctgat gggagcgatc tacttcttca tcttcttctt      2520
     cacactcctg gtcctggctc ggcagaatga gtattactgc cgcctggact tcctgtggaa      2580
     aaagaaactg aggcaggagc gagaggagac tgagacaatg gagaacctga cccggctcct      2640
     cctggagaat gtactccctg cacacgtggc cccccagttc atcggccaga accggcgcaa      2700
     tgaggacctc taccaccagt cgtacgaatg cgtttgtgtc ctcttcgcgt cggtcccaga      2760
     ctttaaggaa ttctactctg aatccaacat caaccacgag gggctggagt gcctgcggct      2820
     gctcaatgag atcattgctg actttgatga gctgctctcc aagccaaagt tcagtggagt      2880
     agagaagatc aaaactattg gcagtaccta catggcggcc acaggcttaa atgccacctc      2940
     tggacaggat actcagcagg attctgagag aagctgcagt catctgggca ccatggtgga      3000
     atttgcagtg gccctggggt ctaagctggg agtcatcaac aagcactcgt tcaataactt      3060
     ccgcctgcgt gtggggttga accacggacc agtagtagca ggggtgattg gggcgcagaa      3120
     gccacagtac gacatctggg ggaacacagt gaatgtggcc agccgaatgg agagcacagg      3180
     cgttctcggc aagatccaag tgactgagga gacagcgcgg gccctgcagt ccctgggtta      3240
     cacgtgctat agcagaggca gcatcaaggt caaaggcaaa ggggaactct gtacctactt      3300
     cctgaacaca gacctgacgc ggaccggatc tccctcagca tcctaggcac ctgagctccc      3360
     ctcttcgaag atcctcaata aaatgtctcc gagcaaaaaa aaaaaaaaaa aaaa            3414
//


spacer
spacer