spacer

EBI Dbfetch

ID   BC015083; SV 1; linear; mRNA; STD; MUS; 1841 BP.
XX
AC   BC015083;
XX
DT   08-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus activin A receptor, type II-like 1, mRNA (cDNA clone MGC:13969
DE   IMAGE:3980151), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1841
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1841
RA   Strausberg R.;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 15d1caf9188656e0a0f7e713a27eb90a.
DR   Ensembl-Gn; ENSMUSG00000000530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121718; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: c Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6752957.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1841
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:13969 IMAGE:3980151"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1841
FT                   /gene="Acvrl1"
FT                   /note="synonym: Alk1"
FT   CDS             154..1662
FT                   /codon_start=1
FT                   /product="Acvrl1 protein"
FT                   /db_xref="GOA:Q61288"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61288"
FT                   /protein_id="AAH15083.1"
FT                   /translation="MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFC
FT                   QGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEA
FT                   TQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLIL
FT                   KASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHG
FT                   ESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEH
FT                   GSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSN
FT                   LQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWA
FT                   FGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADP
FT                   VLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH"
FT   misc_feature    238..459
FT                   /note="Activin_recp; Region: Activin types I and II
FT                   receptor domain. This Pfam entry consists of both TGF-beta
FT                   receptor types. This is an alignment of the hydrophilic
FT                   cysteine-rich ligand-binding domains, Both receptor types,
FT                   (type I and II) posses a 9 amino acid cysteine box, with
FT                   the the consensus CCX{4-5}CN. The type I receptors also
FT                   possess 7 extracellular residues preceding the cysteine
FT                   box"
FT   misc_feature    667..756
FT                   /note="GS; Region: GS motif"
FT   misc_feature    760..1617
FT                   /note="pkinase; Region: Protein kinase domain"
XX
SQ   Sequence 1841 BP; 395 A; 527 C; 554 G; 365 T; 0 other;
     ccacgcgtcc ggccccttcc cagtccccgg aggccgccgc gccagccgcg cagatcgaga        60
     cctttcccgg ccccacaggc cggctctgga cgtgagaccc cggccgcctc cggcaaggag       120
     aggcgggggt cgagtcgccc tgtccaaagg accatgacct tggggagctt cagaaggggc       180
     cttttgatgc tgtcggtggc ctttggccta accaggggag acttggcgaa gccttccaag       240
     ctggtgaact gcacttgtga gagcccacac tgcaagagac cattctgcca ggggtcatgg       300
     tgcacagtgg tgctggttcg ggagcagggc aggcaccccc aggtctatcg gggctgcggg       360
     agcctgaacc aggagctctg cttgggacgt cccacagagt ttctgaacca tcactgctgc       420
     tatagatcct tctgcaacca caacgtgtct ctgatgctgg aggccaccca aactccttcg       480
     gaggagccag aagttgatgc ccatctgcct ctgatcctgg gtcctgtgct ggccttgccg       540
     gtcctggtgg ccctgggtgc tctaggcttg tggcgtgtcc ggcggaggca ggagaagcag       600
     cgggatttgc acagtgacct gggcgagtcc agtctcatcc tgaaggcatc tgaacaggca       660
     gacagcatgt tgggggactt cctggacagc gactgtacta cgggcagcgg ctcggggctc       720
     cccttcttgg tgcagaggac ggtagctcgg caggttgcgc tggtagagtg tgtgggaaag       780
     ggccgatatg gtgaggtgtg gcgcggttcg tggcatggcg agagtgtggc ggtcaagatt       840
     ttctcctcac gagatgagca gtcctggttc cgggagacgg agatctacaa cacagttctg       900
     cttagacacg acaacatcct aggcttcatc gcctccgaca tgacttcgcg gaactcgagc       960
     acgcagctgt ggctcatcac ccactaccat gaacacggct ccctctatga ctttctgcag      1020
     aggcagacgc tggagcccca gttggccctg aggctagctg tgtccgcggc ctgcggcctg      1080
     gcgcacctac atgtggagat ctttggcact caaggcaaac cagccattgc ccatcgtgac      1140
     ctcaagagtc gcaatgtgct ggtcaagagt aacttgcagt gttgcattgc agacctggga      1200
     ctggctgtga tgcactcaca aagcagcgat tacctggata tcggcaacaa cccccgagtg      1260
     ggtaccaaaa gatacatggc acccgaggtg ctggatgagc acatccgcac agactgcttt      1320
     gagtcgtaca agtggacaga catctgggcc tttggcctag tgctatggga gatcgcccgg      1380
     cggaccatca tcaatggcat tgtggaggat tacaggccac ctttctatga catggtaccc      1440
     aatgacccca gttttgagga catgaaaaag gtggtgtgcg ttgaccagca gacacccacc      1500
     atccctaacc ggctggctgc agatccggtc ctctccgggc tggcccagat gatgagagag      1560
     tgctggtacc ccaacccctc tgctcgcctc accgcactgc gcataaagaa gacattgcag      1620
     aagctcagtc acaatccaga gaagcccaaa gtgattcact agcccagggc caccaggctt      1680
     cctctgccta aagtgtgtgc tggggcagaa gacatagcct gtctgggtag agggagtgaa      1740
     gagagtgtgc acgctgccct gtgtgtgcct gctcagcttg gctcccagcc catccagcca      1800
     aaaatacagc tgagctgaaa ttcgaaaaaa aaaaaaaaaa a                          1841
//


spacer
spacer