spacer

EBI Dbfetch

ID   BC014875; SV 1; linear; mRNA; STD; MUS; 2029 BP.
XX
AC   BC014875;
XX
DT   08-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus adiponectin receptor 1, mRNA (cDNA clone MGC:6920
DE   IMAGE:2811173), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2029
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2029
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c8a11a96acd33d03e7741269a90ac743.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: d Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 38259185.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2029
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:6920 IMAGE:2811173"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2029
FT                   /gene="Adipor1"
FT                   /note="synonyms: Paqr1, ACDCR1, CGI-45"
FT   CDS             201..1328
FT                   /codon_start=1
FT                   /gene="Adipor1"
FT                   /product="adiponectin receptor 1"
FT                   /db_xref="GOA:Q91VH1"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1919924"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VH1"
FT                   /protein_id="AAH14875.1"
FT                   /translation="MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSP
FT                   AKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWL
FT                   KDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYF
FT                   MAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVP
FT                   WLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVP
FT                   TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIF
FT                   HVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL"
FT   misc_difference 2008..2029
FT                   /gene="Adipor1"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2029 BP; 469 A; 533 C; 510 G; 517 T; 0 other;
     gggcagggcg ctgaggatcg ggcgcccctc ggccgcaggc cgcctccagt gccgcgggat        60
     gtagcgcccg ggcccgcggc ccccagcaga ggcagccagc caggcctgtc caccatcaca       120
     ggaagatctc tgccctctgg ggctgagaga ccccaacctt tcttcaagct gaagctgcca       180
     ggcactgagg taccagccag atgtcttccc acaaaggctc tgccggggca caaggcaatg       240
     gggctccttc tggtaacaga gaagctgaca cagtggagct ggctgagctg gggcccctgc       300
     tggaggagaa gggcaagcgg gcagccagca gcccagccaa ggctgaggaa gatcaagcat       360
     gcccggtgcc tcaggaagag gaggaggagg tgcgggtgct gacgcttcct ctgcaagccc       420
     accatgccat ggagaagatg gaggagttcg tgtataaggt ctgggaggga cgttggagag       480
     tcatcccgta tgatgtgctt cctgactggc tgaaagacaa cgactacctg ctacatggcc       540
     acagaccacc tatgccctcc tttcgggctt gcttcaagag catcttccgc atccacacag       600
     agactggcaa catctggaca catctgcttg gttttgtgct atttctcttt ctgggaatct       660
     tgacgatgct gagaccaaat atgtacttca tggctcccct gcaggagaag gtggtcttcg       720
     ggatgttctt cctgggcgcg gtgctctgcc tcagtttctc ctggctcttc cacactgtct       780
     actgtcattc agagaaggtc tctcggactt tttccaaact ggactattca gggattgctc       840
     tactgattat ggggagcttc gttccctggc tctattactc cttctactgc tccccacagc       900
     cgcggctcat ctacctctcc atcgtctgtg tcctgggcat ctctgccatc attgtggcac       960
     agtgggaccg gtttgccact cccaagcacc ggcagacaag agcaggagtg ttcctgggac      1020
     ttggcttgag tggtgttgta cccaccatgc actttactat cgctgagggc tttgtcaagg      1080
     ccaccacggt gggccagatg ggctggttct tcctcatggc tgtgatgtac atcaccggcg      1140
     ccggcctgta tgctgctcgg attcctgagc gcttcttccc tggaaaattt gacatctggt      1200
     tccagtctca tcagattttc cacgtcctgg tggtggcagc agctttcgtc cacttctatg      1260
     gtgtgtccaa ccttcaggaa ttccgttatg gcctagaagg tggctgtacc gacgactccc      1320
     ttctctgagc ctccccacct gaggggtgga ggagggactt cccaagtgct tttaaaaata      1380
     acttctttgc tgaagtatga ggaagagtct gagttgtctg tttctagaag aaatctctta      1440
     gagaagtcag taccagtgac atgtcagctc actgtcccag cctccgtccg ggcagtacac      1500
     ttcccatgtg cattcccggc agtcacctcg gcaaggcaac tgctgctcct tcacagatag      1560
     gacgtgggag ctcatgttga gattttaccc attcctccag ccattttggg aaaaaaaaaa      1620
     ttatgaactg ggattcttca gaaattatgt tttgtttttt cttgaagaaa atatcccccc      1680
     cttacccccg tccttacttt gtaacctggc tgataacggg ccatccattt ttgtagcaca      1740
     cttttcagaa acaattataa cctggtccca tctttctagg acaaacaaag ccacgccttg      1800
     atgtagcccg gctaatcatg gaagtacgtc caggcttcaa ataacttgag tttaaatcct      1860
     tttttttttt tttcttggca gagtaatgta aaattaaaat ggggaagata tttaatattt      1920
     aatactaagc tttaaaaaga aacctgctat cactgctatg tatcttgatg caaagactat      1980
     ggtgataata aaagaaagta tagacaaaaa aaaaaaaaaa aaaaaaaaa                  2029
//


spacer
spacer