Dbfetch

ID   BC014807; SV 1; linear; mRNA; STD; MUS; 3076 BP.
XX
AC   BC014807;
XX
DT   08-OCT-2001 (Rel. 69, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus discs, large homolog 4 (Drosophila), mRNA (cDNA clone
DE   MGC:25332 IMAGE:4501403), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3076
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3076
RA   Strausberg R.;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e867871aae4f569cf4881d7c65c4ca18.
DR   Ensembl-Gn; ENSMUSG00000020886; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018579; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018547; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018516; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018519; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018332; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018970; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017887; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018304; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018414; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018404; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018427; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019012; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017661; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017941; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000018700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108589; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030192; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030105; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030124; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029920; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030626; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029619; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029837; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029975; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029966; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030090; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029950; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030654; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029412; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: k Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6681194.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3076
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:25332 IMAGE:4501403"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3076
FT                   /gene="Dlgh4"
FT                   /note="synonyms: SAP90, PSD-95, SAP90A"
FT   CDS             61..2226
FT                   /codon_start=1
FT                   /product="Dlgh4 protein"
FT                   /db_xref="GOA:Q62108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR016313"
FT                   /db_xref="InterPro:IPR019583"
FT                   /db_xref="InterPro:IPR019590"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1277959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62108"
FT                   /protein_id="AAH14807.1"
FT                   /translation="MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTL
FT                   EAPGYVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQ
FT                   DGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKIIEIKLIKG
FT                   PKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKEGRLQIGDKILAVNSVGLEDVMH
FT                   EDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPT
FT                   AMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILA
FT                   GGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEA
FT                   KIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFHFGDVLH
FT                   VIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSV
FT                   LSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRD
FT                   YHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRL
FT                   QAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSF
FT                   EEIYHKVKRVIEDLSGPYIWVPARERL"
FT   misc_feature    235..507
FT                   /note="PDZ; Region: Domain present in PSD-95, Dlg, and
FT                   ZO-1/2. Also called DHR (Dlg homologous region) or GLGF
FT                   (relatively well conserved tetrapeptide in these domains).
FT                   Some PDZs have been shown to bind C-terminal polypeptides"
FT   misc_feature    520..792
FT                   /note="PDZ; Region: Domain present in PSD-95, Dlg, and
FT                   ZO-1/2. Also called DHR (Dlg homologous region) or GLGF
FT                   (relatively well conserved tetrapeptide in these domains).
FT                   Some PDZs have been shown to bind C-terminal polypeptides"
FT   misc_feature    979..1233
FT                   /note="PDZ; Region: Domain present in PSD-95, Dlg, and
FT                   ZO-1/2. Also called DHR (Dlg homologous region) or GLGF
FT                   (relatively well conserved tetrapeptide in these domains).
FT                   Some PDZs have been shown to bind C-terminal polypeptides"
FT   misc_feature    1339..1521
FT                   /note="SH3; Region: Src homology 3 domains"
FT   misc_feature    1654..2184
FT                   /note="GuKc; Region: Guanylate kinase homologues. Active
FT                   enzymes catalyze ATP-dependent phosphorylation of GMP to
FT                   GDP. Structure resembles that of adenylate kinase.
FT                   So-called membrane-associated guanylate kinase homologues
FT                   (MAGUKs) do not possess guanylate kinase activities"
XX
SQ   Sequence 3076 BP; 705 A; 878 C; 850 G; 643 T; 0 other;
     ggaacaaaac tccaatgaag tcagagcccc ctactcgccg ccgcggccag gccccccaac        60
     atggactgtc tctgtatagt gacaaccaag aaataccgct accaagatga agacacgccc       120
     cctctggaac acagcccggc ccacctcccc aaccaggcca attctccccc tgtgattgtc       180
     aacacggaca ccctagaagc cccaggatat gtgaacggaa cagaggggga gatggagtat       240
     gaggagatca cattggaaag gggtaactca ggtctgggct tcagcatcgc aggtggcacc       300
     gacaacccac acatcggtga cgacccatcc atctttatca ccaagatcat tcctggtggg       360
     gctgcagccc aggatggccg cctcagggtc aacgacagca tcctgtttgt caatgaagtg       420
     gatgtccggg aggtgaccca ttcagctgca gtggaggccc tcaaagaggc gggttccatc       480
     gttcgcctct acgtcatgcg ccggaaaccc ccagctgaga agatcataga gatcaagctt       540
     atcaaagggc ctaaaggact tggcttcagc atcgcagggg gcgttgggaa ccagcacatc       600
     cctggagata atagcatcta cgtaaccaag atcatcgaag gaggcgctgc ccacaaggag       660
     ggcaggttgc agatcggaga caagatcctg gcggtcaaca gtgtggggct agaggatgtc       720
     atgcatgagg acgccgtggc agccctgaag aacacatatg acgttgtgta cctaaaggtg       780
     gccaagccca gcaatgccta cctgagtgac agctatgctc ccccagacat cacaacctca       840
     tattctcagc acctggacaa tgagatcagt catagcagct acttgggcac cgactacccc       900
     acagccatga cccccacttc ccctcggcgc tactcccccg tggccaagga cctgctaggg       960
     gaggaagata ttccccggga accaaggcgg atcgtgatcc atcggggctc caccggcctg      1020
     ggcttcaaca ttgtgggcgg cgaggacggt gaaggcatct tcatctcctt catccttgct      1080
     gggggtccag ctgacctcag tggggagcta cggaaggggg accagatcct gtcggtcaat      1140
     ggtgttgacc tccgcaatgc cagtcatgaa caggctgcca ttgccctgaa gaacgcgggt      1200
     cagacggtca cgatcatcgc tcagtataaa ccagaagagt atagccgatt cgaggccaag      1260
     atccatgatc ttcgggaaca gcttatgaat agtagcctgg gctcagggac tgcatctctg      1320
     cgaagcaacc ccaagcgggg cttctatatc agggccctgt ttgactacga caagaccaag      1380
     gactgcggtt tcttgagcca ggccctgagc ttccactttg gggatgtgct tcatgtaatt      1440
     gacgccagcg acgaagagtg gtggcaagcg cggcgggtcc actctgacag tgagaccgat      1500
     gacattggct tcattcccag caaacggcgg gtcgagcgac gagagtggtc aaggttaaag      1560
     gccaaggact ggggctccag ctctggatca cagggtcgag aagactcggt tctgagctat      1620
     gagacggtga cgcagatgga agtgcactac gctcgcccca tcatcatcct tgggcctacc      1680
     aaagaccgtg ccaacgatga tcttctctcc gagttccccg acaagtttgg atcctgtgtc      1740
     cctcatacga cacgtcctaa gcgggaatat gagatagacg gccgcgatta ccactttgtc      1800
     tcctcccggg agaaaatgga gaaggacatt caggcgcaca agttcattga ggctggccag      1860
     tacaacagcc acctctacgg gaccagcgtc cagtctgtgc gagaggtagc agagcagggg      1920
     aagcactgca tccttgatgt ctcagccaat gccgtgcggc ggctgcaggc ggcccacctg      1980
     caccctatcg ccatcttcat ccgtccccgc tccctggaga atgtgctaga gatcaataag      2040
     cggatcacag aggagcaagc ccggaaagcc ttcgacaggg ccacgaagct ggagcaggag      2100
     ttcacggagt gcttctcagc catcgtagag ggcgacagct ttgaagagat ctatcacaaa      2160
     gtgaaacgtg tcatcgaaga cctctcaggc ccctacatct gggtcccagc ccgagagaga      2220
     ctctgattcc tgccctggct tggcctggac tcaccctgcc tccaccacct gggcccttgg      2280
     tctggactga atagcccaag cccttcgtac cctagccttt cttcccaccc ttcttattta      2340
     tttcctttct gactggatcg agcccattgg agggaggaca ctcctctctg catgtatccc      2400
     tgcaccccag atcagggccc ctagacccca ggaacctggg gtctgggggg gagctgggct      2460
     cctggttccg agcccttgct ccttaagact cctacccctg cccgccccca tgcacacaca      2520
     gacccactgg gggcctctgc cctccccatt ttctcccaca cacattccag aagtcagggc      2580
     ccctctcaag gagtacccgc tgtagggatg cagggccaca ggcttccgcg ctctcccgag      2640
     gcaggggctg gggtcacccc tgccccatca taactcccca cgccgtttga gttctccttt      2700
     attttctcca ttcttttctt ctcaaaggtg gtttttgggg ggagaagcag gggggctctc      2760
     ctgagggtcc ccccgtcttt cacacacctc ccaccttttt ttctttgccg gtttgcatga      2820
     gtggaaggtc taactgtggc tttttttttt tctgggattt tatttcattt tatttgattt      2880
     tatttttttg ggaaaagggg agggatgggt ctggggagtg gggaatgtgg gaggggggtg      2940
     ggggggcaaa gggtcagggg ttgggtgtcc gggagccagg ggaggacagg aaatgctgcc      3000
     gccttctgca atttatttat ttttttcttt tgagagagtg aaaggaagag acagacactt      3060
     gaaaaaaaaa aaaaaa                                                      3076
//