Dbfetch

ID   BC014802; SV 1; linear; mRNA; STD; MUS; 2059 BP.
XX
AC   BC014802;
XX
DT   08-OCT-2001 (Rel. 69, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus adenylate kinase 1, mRNA (cDNA clone MGC:25242 IMAGE:4505142),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2059
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2059
RA   Strausberg R.;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 2cf936429d98a306920203371d4e945c.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025615; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025592; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025562; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025589; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025349; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026033; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024811; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025327; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025460; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025422; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025546; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025453; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026091; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024559; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024880; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000068271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113278; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0054183; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0054143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054130; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053858; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054613; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054028; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053806; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053916; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053874; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0054020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054753; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053637; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053132; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: m Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2059
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:25242 IMAGE:4505142"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2059
FT                   /gene="Ak1"
FT   CDS             78..662
FT                   /codon_start=1
FT                   /product="Ak1 protein"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="AAH14802.1"
FT                   /translation="MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA
FT                   EVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEE
FT                   FEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISF
FT                   YDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
FT   misc_feature    114..584
FT                   /note="adenylatekinase; Region: Adenylate kinase"
XX
SQ   Sequence 2059 BP; 454 A; 555 C; 548 G; 502 T; 0 other;
     aggcagggca ctcactggcc ccagcgccca ccacaccctc ccccagagtg ctgacctagc        60
     tcccagatct cagcaggatg gaagagaagc tgaagaaggc caagatcatc tttgtggtgg       120
     gcggacctgg ctcaggaaag ggcacccagt gcgagaagat tgtacagaaa tatggctaca       180
     cccacctgtc tactggggac ctgcttcggg cagaagtcag ctctggatcg gagaggggca       240
     agaagctgtc ggctatcatg gagaagggag agctagtgcc actggacacg gtgctggaca       300
     tgctccgaga tgctatgtta gccaaagtgg attcttccaa tggcttcctg atcgacggct       360
     acccgaggga ggtgaaacag ggagaagaat ttgaacagaa gattggacag cccacactgc       420
     tgctgtatgt ggacgcaggc gccgagacca tgacccaacg actcctgaag cgaggggaga       480
     ccagtggccg cgtggatgac aacgaggaga ccatcaagaa gcggctggag acttattaca       540
     atgccacaga acctgtcatc tccttctatg acaagcgtgg cattgtgcgc aaggtcaatg       600
     ccgaaggcac ggtggacact gtcttctctg aggtctgcac ctatcttgac tccctgaagt       660
     aactggatcc cttggccagc tcccagcccg ccccaccctt gctccctgac cccaggcagc       720
     ctggctcaag cccagcacct ccaccctgcc gggctgtgca cagacacagg aagccatgtt       780
     atcctgtccc atggacacta aagaaattgc caaggagggt taggattgct cctttccttt       840
     gcttccagtt atggtgattc atgctgccac agccggaggc cccagcgtgg ccggcccatt       900
     cttccctgtg cctcagccca gctgtcttgt ctccctctgg ctctgctggg atcctaggcc       960
     cttccttagc caggctgtgt caaagcctag gggtccctgg gttggcaggc tgctctgggg      1020
     ggtctggtgt tcaccctgtt tctcatagcc tcgttgtgtg gctttggccc taagccattg      1080
     tctctctgga gtgagttttc tttttttctt tctttctttt tctttttttt ctttctctgt      1140
     ttctttcttt tttttttttt tttaagacag catctcgtgt gacttaagct ggcctcaacc      1200
     ctgttatgta actaagggca accttaatcc ttctgcctcc acttgtcttc ctgtgtgctg      1260
     agattacagg tgtgtgtgtg gacctccacc actcctggtt ttgggggcac tgggaatcaa      1320
     gcccatggcc ctgtatacga ggccagcacg ctacagagtg agctgcatcc cgggctgggc      1380
     aggttttctg tgcctgactg gggtctggca tgggcaaagg gcaaagggcc atgggctcac      1440
     cagctggggc cacgtggtca ctgggtgcca aggagctgtg caatgggcat acagctaggt      1500
     gggaagctgg ggtcaggggt ggccttcctg aagaaggctc ccttggtata gacctgccag      1560
     gccttgccat cctttggctg gttttaaagc ttgtcctgtc acgctatgtc ccaaccctta      1620
     tcctcggcgt taagacaaga gcatgcagat taaggagtgt gagctgccat agacaaggat      1680
     gtgggatcaa ggaccaggcc tgggacccgg agaggacacc cagggatgcc aagaagagct      1740
     ggcatctctc ttctgctctt tattctttgg tctcattaca caggaagcct ctgttggtac      1800
     tcacttgtcc tggggccccg tctccatccc tagtgacttc ccctgtaagc ccagatagcc      1860
     tgtaagccag cagccatggc tgtcccaggg acacctgccc ctgggggtga cggtgctcac      1920
     tcctttctgt ttactaccag tggggccacc tttccttctg cattgcctat ttaagctgtc      1980
     ctttaaaata aataaatgta tttcagttat aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2040
     aaaaaaaaaa aaaaaaaaa                                                   2059
//