spacer

EBI Dbfetch

ID   BC014767; SV 1; linear; mRNA; STD; MUS; 2240 BP.
XX
AC   BC014767;
XX
DT   08-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus calpain 5, mRNA (cDNA clone MGC:25253 IMAGE:4458488), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2240
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2240
RA   Strausberg R.;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; cb41ced7ff56ad226db19e8e6431c269.
DR   Ensembl-Gn; ENSMUSG00000035547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107112; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: h Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6680845.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2240
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:25253 IMAGE:4458488"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2240
FT                   /gene="Capn5"
FT   CDS             90..2012
FT                   /codon_start=1
FT                   /product="Capn5 protein"
FT                   /db_xref="GOA:O08688"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="MGI:MGI:1100859"
FT                   /protein_id="AAH14767.1"
FT                   /translation="MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTP
FT                   GPTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDW
FT                   KEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALV
FT                   EKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVH
FT                   SRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIR
FT                   LRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKC
FT                   RLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPED
FT                   EVLISIQQRPKRSTRREGKGENLAIGFNIYKVEENRQYRMHSLQHKAASSIYINSRSVF
FT                   LRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQ
FT                   VAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQP
FT                   ITVQVWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCSA
FT                   SLTAV"
FT   misc_feature    111..1136
FT                   /note="CysPc; Region: Calpain-like thiol protease family.
FT                   Calpain-like thiol protease family (peptidase family C2).
FT                   Calcium activated neutral protease (large subunit)"
FT   misc_feature    1146..1577
FT                   /note="Calpain_III; Region: Calpain large subunit, domain
FT                   III. The function of the domain III and I are currently
FT                   unknown. Domain II is a cysteine protease and domain IV is
FT                   a calcium binding domain. Calpains are believed to
FT                   participate in intracellular signaling pathways mediated by
FT                   calcium ions"
XX
SQ   Sequence 2240 BP; 499 A; 651 C; 637 G; 453 T; 0 other;
     agagaacctc agttgctgag gcgggtgctt cactccgtgt cctctttgcc ctatagcagg        60
     tgcctcccct tcttggggac gtggtcacca tgttctcctg cgcgaaggcc tatgaggacc       120
     agaactactc ggcgctgaag cgggcctgcc tgcgcaagaa ggtgctgttc gaggatcccc       180
     tcttccctgc caccgacgac tccctttact ataagggcac cccagggccc acagtcaggt       240
     ggaagcggcc taaggatatc tgcgacgatc cccggctctt cgtagatggc atcagctccc       300
     atgacctgca ccagggccag gtgggcaact gctggtttgt ggctgcctgc tcatcactgg       360
     cctcccgaga gtcactctgg cagaaggtca tcccagactg gaaggagcag gaatggaacc       420
     ccgagaagcc tgacagctat gctggcatct tccacttcaa cttctggcgc tttggggagt       480
     gggtggacgt aatcgtcgat gaccggctgc ccacagtcaa caaccagctc atttactgcc       540
     attccaactc caaaaatgag ttctggtgtg ccctggtgga gaaggcctat gccaagctgg       600
     ccggctgtta ccaggccctg gacggaggca acacggccga tgcattggtg gatttcacag       660
     gtggtgtttc tgaacccatt gacctgaccg agggggactt ggccactgac gaggctaaga       720
     ggaatcagct ctttgagcga gtgctgaagg tgcacagcag aggcgggctc atcagtgcct       780
     ccatcaaggc tgtgacagca gctgacatgg aggcccgcct ggcatgtggc ctggtgaagg       840
     gccatgcata cgctgtcacc gatgtgcgca aggtgcgcct gggccatggc ctgctggcct       900
     tcttcaagtc agagaagctt gatatgatcc gtctgaggaa cccctggggc gagcgggagt       960
     ggacggggcc ctggagtgac acgtcagagg aatggcagaa agtgagcaag agtgagaggg      1020
     agaagatggg cgtgaccgtg caggatgatg gggaattctg gatgaccttt gaggacatgt      1080
     gccggtactt tactgacatc attaaatgcc gcctgattaa cacgtcctac ctgagcatcc      1140
     ataagacatg ggaggaggcc cggctgcatg gtgcctggac gagacatgag gacccacagc      1200
     agaaccgcag tggaggctgc atcaaccaca aggacacttt cttccagaac ccacagtacg      1260
     tatttgaagt caagaagcca gaagatgaag tgttgatcag tatccagcag cggccgaagc      1320
     gctcaactcg ccgggagggc aaaggcgaga atctggccat tggcttcaac atctataagg      1380
     tggaagagaa ccgccaatac cgtatgcaca gcctacagca taaggccgcc agctccatct      1440
     acatcaattc ccgcagcgtt tttttgagga cagagctgcc cgagggccgc tacgttatca      1500
     tccctaccac ctttgagcca ggccacactg gcgagttcct gctccgagtc ttcacagatg      1560
     tcccctccaa ctgccgggaa ctacgcctgg atgagccccc tcggacctgt tggagttccc      1620
     tctgtggcta ccctcagcag gtggcccagg tacatgtcct gggggctgct ggcctcaagg      1680
     actccccaac aggagcaaac tcatatgtga tcatcaagtg tgagggcgaa aaggttcgct      1740
     cagctgtgca gagagggacc tcgacaccag agtacaatgt aaaaggcatc ttctatcgca      1800
     agaagctggc tcagcctatc accgtgcagg tttggaatca ccgagtcctg aaggatgaat      1860
     tcctgggcca ggtgcacctg aagactgccc cggatgacct gcaggacctc cacaccctcc      1920
     atctccagga ccgcagtagc cggcagccca gtgacctgcc aggcattgta gctgtgcgag      1980
     tcctctgcag tgcctctctc acggctgtct gaccccagcc tgcctgtcct gccccactag      2040
     tcctcaccac tcttcgcatg tccccacctt gcctgggacc agcctgggaa ccagacactg      2100
     gggccctttc ctcactcttc cactgaccca ctgtgtgacc tgaagagagc cctgccctct      2160
     cggagcctca gtgtttggag ggccccaaag aattcccgtc ttgtggggga gttttcttgc      2220
     ctaaagaaaa aaaaaaaaaa                                                  2240
//


spacer
spacer