Dbfetch

ID   BC013814; SV 1; linear; mRNA; STD; MUS; 3389 BP.
XX
AC   BC013814;
XX
DT   10-SEP-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus intraflagellar transport 80 homolog (Chlamydomonas), mRNA
DE   (cDNA clone IMAGE:3603535), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3389
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3389
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-SEP-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 22c677769f979101d7b202c7cbecb495.
DR   Ensembl-Gn; ENSMUSG00000027778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169064; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 17 Row: a Column: 13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3389
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="IMAGE:3603535"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..3389
FT                   /gene="Ift80"
FT                   /note="synonym: mKIAA1374"
FT   CDS             <1..1807
FT                   /codon_start=2
FT                   /gene="Ift80"
FT                   /product="Ift80 protein"
FT                   /db_xref="GOA:Q8K057"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1915509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K057"
FT                   /protein_id="AAH13814.1"
FT                   /translation="PNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRV
FT                   LYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSID
FT                   GTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIK
FT                   ASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHS
FT                   YEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLL
FT                   SHKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCD
FT                   TCNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRR
FT                   ADGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAE
FT                   IAYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQINI
FT                   NLYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAK
FT                   IEMEITKERDRSSSGQSSKSVGLKH"
FT   misc_difference 2322^2323
FT                   /gene="Ift80"
FT                   /note="1 base in the mouse genome, A, is not found in cDNA;
FT                   Differences found between this sequence and the mouse
FT                   C57BL/6J genome (build 33) are described in misc_difference
FT                   features below"
FT   misc_difference 3376..3389
FT                   /gene="Ift80"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome; Differences found between this sequence and the
FT                   mouse C57BL/6J genome (build 33) are described in
FT                   misc_difference features below"
XX
SQ   Sequence 3389 BP; 1017 A; 646 C; 736 G; 990 T; 0 other;
     accaaatgct aaagttttac agtggaaagc ccatgatggc atcattttaa aagtcgactg        60
     gaactcagtg aatgacctta ttttatctgc gggtgaagac tgtaagtata aggtttggga       120
     tagttatggc cgcgtgctgt acggctccca gcctcatgag caccccatca cctcagtggc       180
     ctgggctcca gatggggagt tatttgccgt tggatcgttt catacgttac gcttgtgtga       240
     taaaactggg tggtcatatg ctttagagaa acccaacact ggcagcatat ttaacattgc       300
     gtggtctatt gatggcactc agatcgcggg agcctgtggg aacgggcatg ttgtctttgc       360
     acatgtggtg gagcagcgct gggagtggaa aaattttcaa gtaacgctaa cgaagagaag       420
     gaccatgcag gttcgcaacg ttctcaatga tgccgtggat ctcctggagt tccgggacag       480
     agtcattaaa gcatccttaa accacgcaca cttggtggtc tccacgtccc tgcagtgcta       540
     cgtgttctct acgaagaact ggaatacacc acttatattt gatctcaaag aaggaactgt       600
     tagtttaatt ctgcaggcag aaagacattt tcttctggtg gatggcgggg gtatctacct       660
     gcactcttat gaagggcgct tcatttcttc tccaaagttt cctggcatga gaacagacat       720
     cctgaacgct cagactgtgt ctctgagcaa tgacacgata gcaataaagg acaaagctga       780
     cgagaagata atcttcctct ttgaggcgtc aactggaaaa cccctagggg atgggaaact       840
     tctttctcat aagaatgaaa tctcagaaat tgctctggat caaaaaggac ttaccaatga       900
     cagaaaaatt gctttcattg acaagaacag agatctctac atcacctctg tgaaacgatt       960
     tgggaaagaa gaacagatta ttaaacttgg aaccatggta catactttgg catggtgtga      1020
     tacatgcaat atcctctgtg gaattcaaga tactcgattc acagtatggt attaccctaa      1080
     taccatttat gtggacagag acattctgcc taaaacattg tacgaaagag atgcaagtga      1140
     atatagtaaa aacccgcata tagtgagttt tgttggaaat caggtaacta taagaagagc      1200
     tgatggctcc ctggtgcaca tcagcatatc accgtacccc gccatcctcc atgagtatgt      1260
     gagcagctcc aagtgggaag aggctgtaag gctttgccgc tttgttaagg agcaaagcat      1320
     gtgggcttgc ctagcggcta tggctgttgc taatcgagat atggtcactg cagaaatagc      1380
     ctatgcagca gttggggaaa ttgataaagt tcggtacatc aatgctataa aagatcttcc      1440
     atctagagag tcaaaaatgg cccacatact catgtttagt gggaacatcc aggaggctga      1500
     aacagtcctg ctccaggctg gccttgttta tcaagccata cagatcaaca ttaatctcta      1560
     taactgggaa agggcgctgg agttggctgt aaaatacaaa acccacgttg atacagtgct      1620
     cgcttatcgt cagaagttct tggacacatt tggtaaacag gaaactaata aacgatattt      1680
     acaatatgca gagggcctcc aaatagactg ggagaaaatc aaagccaaaa ttgagatgga      1740
     aattactaaa gaacgagacc gatcatccag cggccagtcc agcaagagtg tgggcttaaa      1800
     gcactaaggg ccacgcttac ctccaaacta gtttggacta accaaagatg tgcatgtttg      1860
     tttgctttaa gaagaaaaaa aagcataatt ttaagactag tgcttcctct agatggtagt      1920
     gcacttgcct agcatacatg aggccctggg gctcatcccc agtcaaaaga aaaaggcatt      1980
     gtctttgaat aagtgtatga gttttctgtg tttttaatac ttaaggtacg ttcagaaagg      2040
     ttaagcccaa aataccttat ataattccat catttctatt tttctagtct aataattaag      2100
     aaaatatttc tatatgctta tctatgccca aggagtgttg agtacattcc agtttgtttg      2160
     tttgtttgtt cctttatttc tgtttttttc agtataaata ggtattctta taataaagcc      2220
     ttgagttatt tacaatgtat gttattctga ttgtatgtat tctatttgat atataaattg      2280
     taaagtatct tccatacttt atgaaacaaa aatacaggag aagggtttgg ggaaaatggt      2340
     acaatgtaga tgtatatcga agtttatagt tcacataaca aacgctggga acagctatgg      2400
     tatccatcag ctacaattag ataaaaccac gtggtattca ccggcagtga ttagtctctc      2460
     atagaagggt tgagctgtgg cacatgccgc aacgtggatg agcctaggag aacttccact      2520
     acgtgaagta ggttagacat ggcacagacg tcagtcctgc ggggctcaca caaggcactc      2580
     ggattaagta agttcttctg gtcagaaaag aggcaagagg gacaggccct ggaggaggga      2640
     attcattgtg taacgctggc cattgctgct tggggtgaga gccctagaaa tggagagtgg      2700
     tgatggttgt atagcatcgt gggtgttgtg aactccgttg tcctctttaa aaggattaaa      2760
     atgataaatt ttctttccag ttgttttttt ttttaaacca tattgaaaaa gtagtcaaac      2820
     tgcttttgtt gttgttgtta ctctattgac aaagttggta aactgcattt tcttcattct      2880
     tccctgactt cagaatattt gggcctcaga cttagagtct aaattttcaa aactctcctc      2940
     actggatgac cctgtttgtc tggctttaat ataatgcatc cccaagtccc caaaagcttt      3000
     ttaacagtga cacagacatc cctctaaagt gcccttgacc ctgctcttag aattggtgca      3060
     ttacagagct catgcacact aattgggaaa aacatcaccc ctttccctcc actgtaattt      3120
     ctcatgtagg ttttgttcat agaaatgccc catagttccc aatatgtacc ttttctttta      3180
     tgaaatgttg gactgttcaa ttcttagtct agagtttgga tacacagata tgttcaattc      3240
     atgaaatcta agcaattgac ttatatgtta tacatgcttt ctactttgtt aaatttcagt      3300
     gtaatgtttc aaaagaaaaa aatggttaaa ttttatgttt agtatgttta ccacaataaa      3360
     aaggttaaaa aaaaaaaaaa aaaaaaaaa                                        3389
//