spacer

EBI Dbfetch

ID   BC013670; SV 1; linear; mRNA; STD; MUS; 4035 BP.
XX
AC   BC013670;
XX
DT   10-SEP-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus oxoglutarate dehydrogenase (lipoamide), mRNA (cDNA clone
DE   MGC:19042 IMAGE:4188988), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4035
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4035
RA   Strausberg R.;
RT   ;
RL   Submitted (04-SEP-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 3fccd3b636990185258f5aeb7c6c8d7c.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: h Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4035
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:19042 IMAGE:4188988"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4035
FT                   /gene="Ogdh"
FT                   /note="synonym: 2210412K19Rik"
FT   CDS             58..3129
FT                   /codon_start=1
FT                   /product="Ogdh protein"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAH13670.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPA
FT                   DIISSTDKLGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEF
FT                   MFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLE
FT                   GCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAA
FT                   DEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTE
FT                   GKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSS
FT                   PYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMD
FT                   EPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDE
FT                   KILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGL
FT                   SRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQN
FT                   VDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNM
FT                   AQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDL
FT                   QEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTS
FT                   FDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRI
FT                   EQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRD
FT                   PAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
FT   misc_feature    199..3099
FT                   /note="SucA; Region: 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes [Energy
FT                   production and conversion]"
XX
SQ   Sequence 4035 BP; 970 A; 1089 C; 1034 G; 942 T; 0 other;
     ggcgcttgac acccggagct cgcggccgag ggtacttgtg gaaggcttca ggacaaaatg        60
     tttcatttaa ggacttgtgc tgctaagtta aggccattga cagcctccca gactgttaag       120
     acattttcac aaaacaaacc agcagcaatt aggacgtttc aacagattcg gtgctattct       180
     gcacctgtag ctgctgaacc atttcttagt gggactagtt cgaactatgt ggaggaaatg       240
     tactgtgcct ggttggagaa tcccaaaagt gtacataagt catgggacat ttttttccga       300
     aacaccaatg ctggagcccc accgggcact gcctaccaga gccccctttc cctgagtcga       360
     agctccctgg ctaccatggc ccatgcacag tccctggtgg aagcacaacc taacgtcgac       420
     aaactcgtgg aggaccactt ggcggtgcag tctctcatca gggcatatca gatacgaggg       480
     caccatgtag cacagctgga ccccctgggg attttggatg ctgatctgga ctcctccgtg       540
     cccgctgaca ttatctcatc cacagacaaa cttgggttct atggcctaca cgagtctgac       600
     cttgacaagg tcttccactt acccaccacc actttcatcg ggggacagga gccagcactt       660
     cctcttcggg agatcatccg tcggctggag atggcctact gccagcacat tggtgtggag       720
     ttcatgttca ttaatgattt ggaacaatgc cagtggatcc gacagaagtt tgagacccct       780
     ggaatcatgc agttcaccaa tgaggagaag cggaccttgc tggccaggct tgtacgatcc       840
     accaggtttg aggagttcct acagcgaaag tggtcctcgg agaagcgttt tggtctggaa       900
     ggctgtgagg tgctgatccc tgccctcaag acaatcattg atatgtcaag tgcaaatgga       960
     gtggactatg tgatcatggg gatgccacac agaggacggc tgaacgtgct tgcaaatgtc      1020
     atcaggaagg agctggagca aatattctgt cagtttgact caaagctgga ggcagctgat      1080
     gagggttctg gggacatgaa gtaccacctg ggcatgtatc accgcaggat caaccgtgtg      1140
     accgacagaa acatcacttt gtccttggtg gctaaccctt cccatctaga ggctgctgac      1200
     cctgtcgtga tgggaaagac caaagctgaa cagttctact gtggagacac tgaagggaaa      1260
     aaggtgatgt ctatcctgct gcatggggat gctgcttttg ctggccaggg catcgtatat      1320
     gagaccttcc atctcagcga cttgccgtcc tacacaaccc atggcactgt tcatgtggtt      1380
     gtcaacaacc agattggctt caccacagac cctcggatgg cccgctcctc tccctacccc      1440
     actgatgtgg cccgagtggt gaatgccccc attttccatg tcaactcaga tgaccctgaa      1500
     gctgtcatgt atgtatgcaa ggtggcagct gagtggagaa acaccttcca caaggatgtt      1560
     gtagttgatc tggtgtgtta tcgacgaaat ggccacaatg agatggacga acctatgttt      1620
     acacagccac tcatgtacaa gcagatccgc aagcagaagc ctgtactgca gaagtatgca      1680
     gaattgctag tctcccaggg tgtcgtcaat cagcctgagt acgaggagga aatctccaag      1740
     tatgataaga tctgtgagga agcatttacc agatccaaag atgagaagat cttgcacatc      1800
     aagcactggc tggattcccc ctggcctggc tttttcaccc tggatggaca gcccaggagc      1860
     atgacctgcc cctccactgg cctggaggag gatgtcttgt tccacattgg aaaggtggcc      1920
     agctctgtac ctgtggagaa ctttactatc catggagggc tgagccggat cttgaagacc      1980
     cgcagagagc ttgtgacgaa ccggactgtg gactgggccc tggcagagta catggcattt      2040
     ggctcactgc tgaaggaagg catccatgtg cggctgagtg gccaggatgt ggagcggggc      2100
     accttcagcc atcgccacca tgtgctccat gatcagaatg ttgacaaaag aacctgcatc      2160
     cccatgaacc acctttggcc aaatcaggcc ccttacactg tatgcaacag ctcgctgtct      2220
     gagtacggtg tcctgggctt tgagctgggc tttgccatgg ctagccctaa tgctctggtt      2280
     ctctgggagg cccagtttgg tgacttcaac aacatggcac agtgcatcat tgaccagttc      2340
     atctgcccag gacaggcaaa gtgggtgcgg cagaatggca ttgtgctcct gctgcctcat      2400
     ggcatggaag gcatgggtcc cgagcattcc tctgcccgcc cagagcggtt tctgcagatg      2460
     tgcaatgatg acccagatgt cctgcctgac ctgcaggaag aaaactttga catcaatcag      2520
     ctctatgact gcaactggat tgttgtcaac tgttccaccc ctggcaactt cttccatgtg      2580
     ctgcgacgac agatcttgct gcccttccgg aagccgttaa tcgtcttcac tcccaaatcc      2640
     ctcctgcgcc accctgaggc aagaactagc tttgacgaga tgctgccagg aacgcacttc      2700
     cagcgtgtga tcccagaaaa tggacctgca gctcaggacc cacacaaagt caagagactt      2760
     ctcttctgca ctgggaaggt gtactatgac ctcacccgag agcgcaaagc caggaacatg      2820
     gaggaggagg tggctattac aaggattgag cagctatcac cattcccctt tgacctcctg      2880
     ctgaaagagg cacagaagta tcccaatgct gagctggcct ggtgccagga agagcacaag      2940
     aaccaaggct actatgacta tgtcaagcca agacttcgta ccaccattga ccgtgctaag      3000
     cctgtctggt atgctggccg agacccggca gctgctccag ccactggcaa caagaaaaca      3060
     cacctgacag agctgcagcg ctttctggac acagcctttg acctggacgc attcaagaaa      3120
     ttctcttaga tgctcctgga gttgatgagg ccatggcccc catgtccatg acgctctttg      3180
     cttctcaact aaagaatagt gcctcagcac tgtccacacg tcccttcgct gtgccacacc      3240
     acccctgttc tcataggaat taagttgtcc actgcagtgc tcagctgctc cccggtcaca      3300
     tgctgcccag cctgtgccga cttctctcag gctgcacacc gttcatggag accggaagga      3360
     gcagaataag gaaagggccc ctctcaggac atcctagaga aggaaggcag ctctggcccc      3420
     acccatgccc ccagtgcaat cctccagggt aggaacagaa ccctatgtgg cttcccaggg      3480
     tactagcact cagccctcgt cacccatcaa gtcgcagatt caaggccagg agtagtttca      3540
     tcttgctagg gccaagctga gagctcatgg aggaactata gctgccagga tttgggagtc      3600
     atcaggatgt tgtgtgaata gagattgtca tggggtattt agaggacttt agcagtgatg      3660
     ttagtctagc cctgctaccc ttcttgggtt tgggctgtat gtgggaaact taccccagct      3720
     accacgcctg gagagcttgg ctctgagtac ggcccagaag ctccattggc tcccaacgcc      3780
     aggcactgct gcctcttggt cctgctgcct ctgctctcct gacccctccc cagtcacttc      3840
     attttctctg ttgttccctt gaacacacag aagctgttga cgaattcttt tttttgctgt      3900
     gccaaggcag gtcaaaagca gatcagtgga taagagcaag ttgtcccaag gagccagctg      3960
     tccttcctcc ctcttttgac ctccactggg acacacctga tttatttatt ttggttaaaa      4020
     aaaaaaaaaa aaaaa                                                       4035
//


spacer
spacer