Dbfetch

ID   BC013594; SV 1; linear; mRNA; STD; MUS; 2607 BP.
XX
AC   BC013594;
XX
DT   10-SEP-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus solute carrier organic anion transporter family, member 1a5,
DE   mRNA (cDNA clone MGC:6720 IMAGE:3586426), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2607
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2607
RA   Strausberg R.;
RT   ;
RL   Submitted (04-SEP-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 8020df83683895f593fa7eeb1ecd631f.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 10 Row: a Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 18699999.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2607
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:6720 IMAGE:3586426"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2607
FT                   /gene="Slco1a5"
FT                   /note="synonym: Oatp3"
FT   CDS             139..2151
FT                   /codon_start=1
FT                   /product="Slco1a5 protein"
FT                   /db_xref="GOA:Q91YY5"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1351865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YY5"
FT                   /protein_id="AAH13594.1"
FT                   /translation="MGETEKRIATHGVRCFSKIKMFLLALTCAYVSKSLSGIYMNSMLT
FT                   QIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMS
FT                   LPHFLMGRYEYETTISPTSNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLV
FT                   GNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYV
FT                   DTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVAR
FT                   TENDKEEKHREKAKEENRGITKDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFLP
FT                   KYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEY
FT                   LLSYFHFMISCDNFQVAGLTTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNG
FT                   LSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSGNSSAVLGLCKKGPECANKLQYFLIMS
FT                   VIGSFIYSITAIPGYMVLLRCIKSEEKSLGIGLHAFCTRIFAGIPAPIYFGALIDRTCL
FT                   HWGTLKCGEPGACRIYNINNFRRIYLVLPAALRGSSYLPAFFILILMRKFQLPGEMYSS
FT                   ETELADMKQTVKKSECTDVHGIPKVENDGELKTKL"
FT   misc_feature    253..1362
FT                   /note="OATP_C; Region: Organic Anion Transporter
FT                   Polypeptide (OATP) family, C-terminus. This family consists
FT                   of several eukaryotic Organic-Anion-Transporting
FT                   Polypeptides (OATPs). Several have been identified mostly
FT                   in human and rat. Different OATPs vary in tissue
FT                   distribution and substrate specificity. Since the numbering
FT                   of different OATPs in particular species was based
FT                   originally on the order of discovery, similarly numbered
FT                   OATPs in humans and rats did not necessarily correspond in
FT                   function, tissue distribution and substrate specificity (in
FT                   spite of the name, some OATPs also transport organic
FT                   cations and neutral molecules). Thus, Tamai et al.
FT                   initiated the current scheme of using digits for rat OATPs
FT                   and letters for human ones. Prostaglandin transporter (PGT)
FT                   proteins are also considered to be OATP family members. In
FT                   addition, the methotrexate transporter OATK is closely
FT                   related to OATPs. This family aligns residues towards the
FT                   C-terminus. The family OATP_N aligns residues from similar
FT                   proteins towards the N-terminus. This family also includes
FT                   several predicted proteins from Caenorhabditis elegans and
FT                   Drosophila melanogaster. This similarity was not previously
FT                   noted. Note: Members of this family are described as
FT                   belonging to the SLC21 family of transporters"
FT   misc_feature    1600..2088
FT                   /note="OATP_N; Region: Organic Anion Transporter
FT                   Polypeptide (OATP) family, N-terminus. This family consists
FT                   of several eukaryotic Organic-Anion-Transporting
FT                   Polypeptides (OATPs). Several have been identified mostly
FT                   in human and rat. Different OATPs vary in tissue
FT                   distribution and substrate specificity. Since the numbering
FT                   of different OATPs in particular species was based
FT                   originally on the order of discovery, similarly numbered
FT                   OATPs in humans and rats did not necessarily correspond in
FT                   function, tissue distribution and substrate specificity (in
FT                   spite of the name, some OATPs also transport organic
FT                   cations and neutral molecules). Thus, Tamai et al.
FT                   initiated the current scheme of using digits for rat OATPs
FT                   and letters for human ones. Prostaglandin transporter (PGT)
FT                   proteins are also considered to be OATP family members. In
FT                   addition, the methotrexate transporter OATK is closely
FT                   related to OATPs. This family aligns residues towards the
FT                   N-terminus. The family OATP_C aligns residues from similar
FT                   proteins towards the C-terminus. This family also includes
FT                   several predicted proteins from Caenorhabditis elegans and
FT                   Drosophila melanogaster. This similarity was not previously
FT                   noted. Note: Members of this family are described as
FT                   belonging to the SLC21 family of transporters"
XX
SQ   Sequence 2607 BP; 779 A; 543 C; 553 G; 732 T; 0 other;
     atttgctgct gtgaatttct ttttccgtca ccagcgagaa caccattttc taaagcttct        60
     tcatgtatgt acttctcatt tggccaagtg gtaagactgt ttaaagaata gtcatttgga       120
     gacaatcaga agaacaacat gggagaaaca gagaaaagga ttgcaaccca tggggtcaga       180
     tgcttttcta agatcaagat gtttctgttg gcattaacat gtgcatatgt atccaaatca       240
     ctctcaggaa tttatatgaa ttccatgctt acacaaatag agagacaatt tgatatcccc       300
     acatctatag ttggacttat caatgggagc tttgagattg gaaatctttt gttgattata       360
     ctcgtgagtt actttggaac aaaattgcac agacccatca tgattggtat tggatgtgtg       420
     attatgggcc tagggtgttt cttaatgtcc ttacctcatt tcctcatggg ccgatacgaa       480
     tatgaaacaa cgatttcacc tacaagcaac ttgtcctcaa acagcttctt gtgtatggaa       540
     aacagaacac agaccttaaa gccaacgcaa gaccctgcag agtgtgtgaa agaaatgaaa       600
     tcattaatgt ggatatatgt actggtagga aacatcatac gtggaattgg tgaaactccc       660
     atcatgccct tgggtatttc ctacatagaa gattttgcca aatctgaaaa ctctccttta       720
     tatattggga ttttagaatc aggaaagatg attggcccga ttgttggact tttgttggga       780
     tccttctgtg caagaattta tgtagacaca gggtctgtga atacagatga cctgaccata       840
     actcccactg atacacgctg ggtcggtgct tggtggattg gctttttggt ctgtgcagga       900
     gtgaatatcc tgaccagcat cccctttttc ttctttccaa aaacactccc aaaggaagga       960
     ttacaggata atgtggctag aactgaaaat gacaaagagg agaagcacag agaaaaagcc      1020
     aaggaggaaa accgaggaat cactaaagat ttcctgccat tcatgaagag cctctcctgc      1080
     aatcctattt acatgcttct catcctgaca agcgtgctcc agataaacgc atttatcaat      1140
     atgtttacct tcttgcccaa atacctggag cagcagtatg gaaaatccac ttcagaggtc      1200
     gtcctcctca taggtgtttg taacttacct ccaatctgca ttggatattt acttattggc      1260
     tttattatga agaagttcag gattactgtc aagaaggctg catacatggc attctgccta      1320
     tccctgtttg agtaccttct gtcttacttt cactttatga taagctgtga taatttccaa      1380
     gttgctggct taactacctc ttatgaagga gttcagcacc ctctatatgt ggagaacaag      1440
     gtccttgctg actgcaacac aaggtgtagc tgcttaacaa acacatggga tccagtgtgt      1500
     ggagacaatg gcctatcata catgtcagcc tgccttgcgg gctgtgagaa gtctgttgga      1560
     atgggaaccc acatggtgtt tcaaaattgc agctgcattc agtcatcagg aaactcatct      1620
     gcagtcctgg ggctgtgtaa aaaaggccct gagtgtgcta acaagctgca gtacttttta      1680
     atcatgtcgg taattggcag tttcatctat tcgatcacag ccatacctgg gtacatggtt      1740
     cttctgaggt gtatcaagtc tgaagagaag tcacttggaa ttggattaca cgcattttgc      1800
     acaagaatat ttgctggcat ccctgcaccc atttactttg gagctttgat agacagaacc      1860
     tgcttacatt ggggaactct gaaatgtggt gagccaggag catgtaggat atacaatata      1920
     aataacttca ggcgcattta tctagtgttg cctgcagcac taagaggatc aagctatctc      1980
     cctgcattct tcattctaat acttatgagg aaattccagc tccctgggga aatgtactct      2040
     tcagaaactg aacttgcaga catgaagcaa acagtgaaga aaagcgagtg cacagatgtg      2100
     cacggaattc ctaaggtcga gaatgatgga gaactgaaaa ctaagctgta atgaatggca      2160
     atggaaacct gctggcctgt gcaaggctct gaacagaatg cacattgcac ttcctttgaa      2220
     tcatgagagg tacgagagaa ctcctttcct aaaataaatc agggctggac acagtgtaag      2280
     atattctcaa aagtcaccgt ctcatcctca ggaggcctct ggtgctcact cattctagtc      2340
     acatatccca gagcacagtg ctactttcaa aatcatctta aagtaaaacc tttgaagagg      2400
     ggccacctaa atggcccaat ggaaaggtgt gctttctacc aaggctgaca aggtgtgttt      2460
     gatccttggg accaacatgg cagaaggaca gaaccaacct cgctttcagg ttgtcctttt      2520
     ctctctactc ccgcactgtg gtgtgcatat cccaccccaa acaaacaaac aaataaaaaa      2580
     atttagaaac taaaaaaaaa aaaaaaa                                          2607
//