spacer

EBI Dbfetch

ID   BC013452; SV 1; linear; mRNA; STD; MUS; 1398 BP.
XX
AC   BC013452;
XX
DT   10-SEP-2001 (Rel. 69, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus Mpv17 transgene, kidney disease mutant, mRNA (cDNA clone
DE   MGC:18538 IMAGE:4237284), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1398
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1398
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-SEP-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e9b4a43dfbd5e24e6c4e9b5904d9370d.
DR   Ensembl-Gn; ENSMUSG00000090262; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154241; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 25 Row: i Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678925.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1398
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:18538 IMAGE:4237284"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1398
FT                   /gene="Mpv17"
FT   CDS             20..550
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /product="Mpv17 transgene, kidney disease mutant"
FT                   /db_xref="GOA:P19258"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="MGI:MGI:97138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19258"
FT                   /protein_id="AAH13452.1"
FT                   /translation="MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQ
FT                   HQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCF
FT                   LPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAI
FT                   VWNSYLSWKAHQF"
XX
SQ   Sequence 1398 BP; 371 A; 344 C; 343 G; 340 T; 0 other;
     gagctggcac tcagggagca tggcactctg gcgagcatac cagagagccc tggcagcaca        60
     tccgtggaaa gtccaggttc tgacagctgg atcactgatg ggcgtaggtg acatgatctc       120
     acagcagctg gtggagaggc ggggtctcca gcaacaccag gcaggccgca ctctgaccat       180
     ggtatccctg ggctgtggct ttgtgggccc tgtcgtcgga ggctggtaca aagttttaga       240
     ccacttaatc ccgggcacca cgaaggtgca tgcactgaag aagatgttgt tagatcaggg       300
     gggctttgcc ccatgtttcc taggctgctt tctcccactg gtcgggatac tcaatggaat       360
     gtcagcccag gacaattggg ccaaactgaa gcgggactac cctgatgccc tcatcaccaa       420
     ctactatctc tggcctgctg tgcagttagc caacttctac ctggtccccc tgcattacag       480
     gttggctgtt gtccagtgtg ttgctattgt ctggaactcc tacctatcct ggaaggcaca       540
     tcagttctaa gcgtgccttg ttccatggtt tgcaccttgt actgatgcac cgtgaccctg       600
     gaatgcttgg acagcttctt caaactaacc acatcaggac tggagcggtg actcagctgt       660
     tagaagcacg gattatctgc tctacagagg acctaaattt ggttccaagc acccacatcg       720
     ggtggctcac aactccctat gtctcaagct ccaggagatc tgatgttctc ttctggcctc       780
     tgaagcacct gcacaaacat gtatataccc acgaatagac acgcatttgt aattaagcac       840
     acaatgaaat ctttaaaagg aaggagtgtg tcagcttcca tgctatgggg ttgctgatca       900
     gaatagggtg accactctga agtggcacat ttcactttaa ccactaagac atttataata       960
     ttgctgtcac tctggccctt agctgatggg gacacactat aagaattgtg tcctgggggc      1020
     tggagagatg gctcagcctg taagagcact gactgctctt cagaagctcc tgagttcaaa      1080
     tcccagcaac cacatggtgg ctcacaacca tctgtaaaga gatctgacgc cctcttctgg      1140
     agtgtctgaa gacagctaca gtgtactcat atttaattaa ttaattaata attaattaat      1200
     taatatagaa ttgtgtcctg gaagccaggc atggtggtac atgccttcaa tcccagcact      1260
     tgggaggcag aggcaggcag atttctgagt tcaaggtcag cctagtctac agagtgagtt      1320
     ccaggacagc cagggctata cagagaaacc ctgtgtcagg aaaaaaaaca aaaaaacaaa      1380
     accaaaaaaa aaaaaaaa                                                    1398
//


spacer
spacer