spacer

EBI Dbfetch

ID   BC013341; SV 1; linear; mRNA; STD; MUS; 1453 BP.
XX
AC   BC013341;
XX
DT   06-SEP-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus arginase, liver, mRNA (cDNA clone MGC:13983 IMAGE:4163626),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1453
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1453
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cf8ec16003e3e15209de6a19f2cc9b99.
DR   Ensembl-Gn; ENSMUSG00000019987; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020161; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: j Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982504.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1453
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:13983 IMAGE:4163626"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1453
FT                   /gene="Arg1"
FT                   /note="synonyms: PGIF, AI, arginase I"
FT   misc_difference 6..7
FT                   /gene="Arg1"
FT                   /note="in the mouse genome : GT."
FT   misc_difference 9
FT                   /gene="Arg1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   CDS             80..1051
FT                   /codon_start=1
FT                   /gene="Arg1"
FT                   /product="arginase, liver"
FT                   /db_xref="GOA:Q61176"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="MGI:MGI:88070"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61176"
FT                   /protein_id="AAH13341.1"
FT                   /translation="MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEY
FT                   DVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLA
FT                   VGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFS
FT                   WVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGR
FT                   KKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPT
FT                   LGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK"
FT   misc_difference 781
FT                   /gene="Arg1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 988
FT                   /gene="Arg1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1105
FT                   /gene="Arg1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1147
FT                   /gene="Arg1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1158
FT                   /gene="Arg1"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1167
FT                   /gene="Arg1"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 1171
FT                   /gene="Arg1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1180
FT                   /gene="Arg1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1442..1453
FT                   /gene="Arg1"
FT                   /note="polyA tail: 12 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1453 BP; 440 A; 324 C; 368 G; 321 T; 0 other;
     ccacgcgtcc ggccggtgga gaggagctgg acagcccgag cacatgcagc agcagcagcc        60
     gctggaaccc agagagagca tgagctccaa gccaaagtcc ttagagatta tcggagcgcc       120
     tttctcaaaa ggacagcctc gaggaggggt agagaaaggc cctgcagcac tgaggaaagc       180
     tggtctgctg gaaaaactta aagaaacaga gtatgacgtg agagaccacg gggacctggc       240
     ctttgttgat gtccctaatg acagctcctt tcaaattgtg aagaacccac ggtctgtggg       300
     gaaagccaat gaagagctgg ctggtgtggt ggcagaggtc cagaagaatg gaagagtcag       360
     tgtggtgctg ggtggagacc acagtctggc agttggaagc atctctggcc acgccagggt       420
     ccaccctgac ctatgtgtca tttgggtgga tgctcacact gacatcaaca ctcccctgac       480
     aaccagctct gggaatctgc atgggcaacc tgtgtccttt ctcctgaagg aactgaaagg       540
     aaagttccca gatgtaccag gattctcctg ggtgactccc tgcatatctg ccaaagacat       600
     cgtgtacatt ggcttgcgag acgtagaccc tggggaacac tatataataa aaactctggg       660
     aattaagtat ttctccatga ctgaagtaga caagctgggg attggcaagg tgatggaaga       720
     gaccttcagc tacctgctgg gaaggaagaa aaggccgatt cacctgagct ttgatgtcga       780
     tgggctggac ccagcattca ccccggcgac cggcaccccg gttctgggag gcctatctta       840
     cagagaaggt ctctacatca cagaagaaat ttacaagaca gggctccttt caggactaga       900
     tatcatggaa gtgaacccaa ctcttgggaa gacagcagag gaggtgaaga gtactgtgaa       960
     cacggcagtg gctttaacct tggcttgttt cggaactcaa cgggagggta accataagcc      1020
     agggactgac taccttaaac cacctaagtg actgtgaatg cgccacatga aaaccatctg      1080
     gggcatcaca gcaaagcaga cagagctaag caaacgcctt ctcctcccaa gggcttgttc      1140
     ttttaggaaa aaaaaaattt tttttttcca ataagtatgc atcccagcag ttcctttctg      1200
     gtatgaaatt caggatgtgg aaatcaaaac agctataaaa ctaggaaaca tgtattcccc      1260
     attttagcat aagttatcct taagaagtag tatccaatta attttcaatt aaaaaatgca      1320
     ccagcattta aaatacacgg tgatgttaag tgtcaattca cagttggaag caaaggtatc      1380
     cagagaggta gcctatatcc acgctgttca aaagatgtat aataaactct ttataataaa      1440
     aaaaaaaaaa aaa                                                         1453
//


spacer
spacer