spacer

EBI Dbfetch

ID   BC013293; SV 2; linear; mRNA; STD; HUM; 1208 BP.
XX
AC   BC013293;
XX
DT   30-AUG-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Homo sapiens synuclein, alpha (non A4 component of amyloid precursor), mRNA
DE   (cDNA clone MGC:3484 IMAGE:3604532), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1208
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1208
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5ac857d238fc357c54a7c22d93e5da36.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
DR   EuropePMC; PMC2920329; 20711464.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:15342041.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 11 Row: l Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6806897.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1208
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_44"
FT                   /clone="MGC:3484 IMAGE:3604532"
FT                   /tissue_type="Uterus, endometrium adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1208
FT                   /gene="SNCA"
FT                   /note="synonyms: PD1, NACP, PARK4"
FT   misc_difference 350
FT                   /gene="SNCA"
FT                   /note="1 base in cDNA is not found in the human genome."
FT   CDS             424..846
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="synuclein, alpha (non A4 component of amyloid
FT                   precursor)"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000036190.15"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /protein_id="AAH13293.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
FT   misc_difference 1159^1160
FT                   /gene="SNCA"
FT                   /note="1 base in the human genome, T, is not found in
FT                   cDNA."
FT   misc_difference 1170..1208
FT                   /gene="SNCA"
FT                   /note="polyA tail: 39 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1208 BP; 327 A; 272 C; 328 G; 281 T; 0 other;
     agagaggggg cgagcgaccg agcgccgcga cgcggaagtg aggtgcgtgc gggctgcagc        60
     gcagaccccg gcccggcccc tccgagagcg tcctgggcgc tccctcacgc cttgccttca       120
     agccttctgc ctttccaccc tcgtgagcgg agaactggga gtggccattc gacgacaggt       180
     tagcgggttt gcctcccact cccccagcct cgcgtcgccg gctcacagcg gcctcctctg       240
     gggacagtcc cccccgggtg ccgcctccgc ccttcctgtg cgctcctttt ccttcttctt       300
     tcctattaaa tattatttgg gaattgttta aatttttttt ttaaaaaaaa gagagaggcg       360
     gggaggagtc ggagttgtgg agaagcagag ggactcagtg tggtgtaaag gaattcatta       420
     gccatggatg tattcatgaa aggactttca aaggccaagg agggagttgt ggctgctgct       480
     gagaaaacca aacagggtgt ggcagaagca gcaggaaaga caaaagaggg tgttctctat       540
     gtaggctcca aaaccaagga gggagtggtg catggtgtgg caacagtggc tgagaagacc       600
     aaagagcaag tgacaaatgt tggaggagca gtggtgacgg gtgtgacagc agtagcccag       660
     aagacagtgg agggagcagg gagcattgca gcagccactg gctttgtcaa aaaggaccag       720
     ttgggcaaga atgaagaagg agccccacag gaaggaattc tggaagatat gcctgtggat       780
     cctgacaatg aggcttatga aatgccttct gaggaagggt atcaagacta cgaacctgaa       840
     gcctaagaaa tatctttgct cccagtttct tgagatctgc tgacagatgt tccatcctgt       900
     acaagtgctc agttccaatg tgcccagtca tgacatttct caaagttttt acagtgtatc       960
     tcgaagtctt ccatcagcag tgattgaagt atctgtacct gcccccactc agcatttcgg      1020
     tgcttccctt tcactgaagt gaatacatgg tagcagggtc tttgtgtgct gtggattttg      1080
     tggcttcaat ctacgatgtt aaaacaaatt aaaaacacct aagtgactac cacttatttc      1140
     taaatcctca ctattttttg ttgctgttga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1200
     aaaaaaaa                                                               1208
//


spacer
spacer