Dbfetch

ID   BC012724; SV 1; linear; mRNA; STD; MUS; 1355 BP.
XX
AC   BC012724;
XX
DT   21-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus insulin-like growth factor binding protein 2, mRNA (cDNA clone
DE   MGC:14074 IMAGE:2654907), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1355
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1355
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (15-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b230c520e94e482156e777f21a07726b.
DR   Ensembl-Gn; ENSMUSG00000039323; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016136; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016076; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016074; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015905; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016527; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015489; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015878; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015982; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016051; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016002; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016574; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015276; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015551; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000047328; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020443; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0020420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0020378; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020192; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0020154; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0020265; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0020277; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0020347; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020242; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020927; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019461; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019783; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: a Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982259.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1355
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:14074 IMAGE:2654907"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1355
FT                   /gene="Igfbp2"
FT   misc_difference 1..6
FT                   /gene="Igfbp2"
FT                   /note="6 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 33
FT                   /gene="Igfbp2"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   CDS             89..1006
FT                   /codon_start=1
FT                   /gene="Igfbp2"
FT                   /product="insulin-like growth factor binding protein 2"
FT                   /db_xref="GOA:P47877"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR012210"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR022321"
FT                   /db_xref="InterPro:IPR036857"
FT                   /db_xref="MGI:MGI:96437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47877"
FT                   /protein_id="AAH12724.1"
FT                   /translation="MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTP
FT                   ERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELP
FT                   LKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLK
FT                   SGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMR
FT                   LPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIR
FT                   GDPECHLFYNEQQETGGAHAQSVQ"
FT   misc_difference 895
FT                   /gene="Igfbp2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1319..1355
FT                   /gene="Igfbp2"
FT                   /note="polyA tail: 37 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1355 BP; 300 A; 409 C; 412 G; 234 T; 0 other;
     ccacgcgtcc gggaggcgtc tcccgcattc gtatgggccg tgccacctgc ccgctagctc        60
     gctgcactac cgttgcccac aagccaacat gctgccgaga ttgggcggcc ccgcgctgcc       120
     gctgctcctg ccgtcgttgc tcttgctgct gctcttgggc gcgggcggct gcggccccgg       180
     ggtgcgcgcc gaggtgctgt tccgctgccc accctgcacg cccgagcgtc tggccgcttg       240
     cgggccccca cccgacgcgc cctgcgccga gctggtgcga gagcccggct gcggctgctg       300
     ctccgtgtgc gcacggcagg agggcgaagc atgcggcgtc tacatcccgc gctgcgccca       360
     gacgctacgc tgctatccca acccgggctc cgagctgccc ctgaaggcgc ttgtcacagg       420
     cgcgggtacc tgtgaaaaga gacgcgtggg caccacccca cagcaggttg cagacagtga       480
     tgacgaccac tctgagggag gcctggtgga gaaccacgtg gatgggacca tgaacatgtt       540
     gggaggtggt agcagtgctg gccggaagcc cctcaagtca ggcatgaagg agctggctgt       600
     gttccgggag aaggtcaatg aacagcaccg gcagatgggc aagggtgcca aacacctcag       660
     tctggaggag cccaagaagt tgcgcccgcc tcccgccagg accccttgcc agcaggagtt       720
     ggaccaggtc ctggagcgga tctccaccat gcgccttccg gatgatcggg gccccctgga       780
     acatctctac tccctgcaca tccccaactg tgacaagcat ggccggtaca accttaagca       840
     gtgcaagatg tctctgaacg gacagcgcgg ggagtgctgg tgtgtgaacc ccaacaccgg       900
     gaagcccatc cagggagctc ccaccatccg gggagacccc gagtgccatc tcttctacaa       960
     cgagcagcag gagactggtg gggcccatgc ccaaagtgtg cagtaaaccc cagccagtcg      1020
     gtgcctggct tccccatccc gaacaccagc agaaatggag ggcgtcaggg tgacgggtgt      1080
     ggaggagttc ccagttttga cacatgtatt tatatttgga aagagaccaa cactgagctc      1140
     agaagccccc ctctgacccc ccccagcggc tgttaagctg aacctccctt gcttctgtta      1200
     gagaggggaa gggtggtatg gagggcactg ggtacaggcc tgggaatggg gaaagaaatt      1260
     tttatttttg aatccctgtg tctcttttac ttaagattaa aggaaggaaa aataaaaaaa      1320
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                                 1355
//