spacer

EBI Dbfetch

ID   BC012639; SV 1; linear; mRNA; STD; MUS; 937 BP.
XX
AC   BC012639;
XX
DT   21-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus glutathione S-transferase, alpha 4, mRNA (cDNA clone MGC:13725
DE   IMAGE:3995378), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-937
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-937
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (15-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 403c134fabf76bcdb87844827538fbfb.
DR   Ensembl-Gn; ENSMUSG00000032348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034903; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: e Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754081.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..937
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:13725 IMAGE:3995378"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..937
FT                   /gene="Gsta4"
FT                   /note="synonyms: mGsta4, GST 5.7, 5.7, GST"
FT   misc_difference 1..8
FT                   /gene="Gsta4"
FT                   /note="8 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 65
FT                   /gene="Gsta4"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 68
FT                   /gene="Gsta4"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 70
FT                   /gene="Gsta4"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             74..742
FT                   /codon_start=1
FT                   /gene="Gsta4"
FT                   /product="glutathione S-transferase, alpha 4"
FT                   /db_xref="GOA:P24472"
FT                   /db_xref="InterPro:IPR003080"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:1309515"
FT                   /db_xref="PDB:1B48"
FT                   /db_xref="PDB:1GUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24472"
FT                   /protein_id="AAH12639.1"
FT                   /translation="MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQ
FT                   KDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMM
FT                   MIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
FT                   ILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
FT                   "
FT   misc_difference 768
FT                   /gene="Gsta4"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 913..937
FT                   /gene="Gsta4"
FT                   /note="polyA tail: 25 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 937 BP; 289 A; 220 C; 230 G; 198 T; 0 other;
     ccacgcgtcc gcttctttcc agtgcctgga gacaacaatc ccacaagaat aaggaagctc        60
     tgaaccaagg gtcatggcag ccaaacctaa gctctactac tttaatggca ggggacggat       120
     ggagtcgatc cgctggctgc tggctgcggc tggagtggag tttgaggaag aatttcttga       180
     gacaagggaa cagtatgaga agatgcaaaa ggatggacac ctgcttttcg gccaagtacc       240
     cttggttgaa atcgatggga tgatgctgac acagaccagg gccatcctca gctacctcgc       300
     tgccaagtac aacttgtatg ggaaggacct gaaggagaga gtcaggattg acatgtatgc       360
     agatggcacc caggacctga tgatgatgat tgccgtggct ccatttaaaa cccccaagga       420
     aaaagaggag agctatgatt tgatactgtc aagagctaaa acccgttact tcccagtgtt       480
     tgaaaagatt ttaaaagacc acggagaggc ttttctcgtt ggcaaccagc tcagttgggc       540
     agacatccag ctcctagaag ccattttgat ggtggaagaa ctcagtgccc ctgtactgtc       600
     cgacttccct ctgctgcagg catttaagac aagaatcagc aacattccta caattaagaa       660
     gttcctgcaa cccggaagtc agaggaagcc tcctccagat ggcccctatg ttgaggtggt       720
     caggactgtc ctgaagttct agtgcagcgt gctttaaggt ggcacccgca aggttccaat       780
     tgcagtgtca ccacaggcca gctgcagagc attccagaag caaggtatat agatcccagg       840
     agtcaagctc ttcaaacaac aaaaccactc tgcccacaat gacaaatgcc aattaaatac       900
     agtggaaaac taaaaaaaaa aaaaaaaaaa aaaaaaa                                937
//


spacer
spacer