Dbfetch

ID   BC012407; SV 1; linear; mRNA; STD; MUS; 1881 BP.
XX
AC   BC012407;
XX
DT   21-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus aldehyde dehydrogenase family 7, member A1, mRNA (cDNA clone
DE   MGC:18699 IMAGE:4191228), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1881
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1881
RA   Strausberg R.;
RT   ;
RL   Submitted (15-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 4654b7d4fe71ecf9077f10be53f39867.
DR   Ensembl-Gn; ENSMUSG00000053644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174518; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: i Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20070417.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1881
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:18699 IMAGE:4191228"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1881
FT                   /gene="Aldh7a1"
FT   CDS             121..1656
FT                   /codon_start=1
FT                   /product="Aldh7a1 protein"
FT                   /db_xref="GOA:Q9DBF1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="MGI:MGI:108186"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DBF1"
FT                   /protein_id="AAH12407.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFEDA
FT                   DLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNIL
FT                   YGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQE
FT                   TFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIP
FT                   TSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ"
FT   misc_feature    223..1614
FT                   /note="aldedh; Region: Aldehyde dehydrogenase family. This
FT                   family of dehydrogenases act on aldehyde substrates.
FT                   Members use NADP as a cofactor. The family includes the
FT                   following members: The prototypical members are the
FT                   aldehyde dehydrogenases EC:1.2.1.3. Succinate-semialdehyde
FT                   dehydrogenase EC:1.2.1.16. Lactaldehyde dehydrogenase
FT                   EC:1.2.1.22. Benzaldehyde dehydrogenase EC:1.2.1.28.
FT                   Methylmalonate-semialdehyde dehydrogenase EC:1.2.1.27.
FT                   Glyceraldehyde-3-phosphate dehydrogenase EC:1.2.1.9.
FT                   Delta-1-pyrroline-5-carboxylate dehydrogenase EC: 1.5.1.12.
FT                   Acetaldehyde dehydrogenase EC:1.2.1.10.
FT                   Glutamate-5-semialdehyde dehydrogenase EC:1.2.1.41. This
FT                   family also includes omega crystallin an eye lens protein
FT                   from squid and octopus that has little aldehyde
FT                   dehydrogenase activity"
XX
SQ   Sequence 1881 BP; 468 A; 451 C; 538 G; 424 T; 0 other;
     ccctggcgga ggggcttctt gcgtgctgag ctcagtatgt ggcgtgtgcc ccgcaggctc        60
     tgtgtgcagt ctgtgaagac cagcaagctt tccggacctt ggagcaggcc cgccgcccac       120
     atgtctactc tgctgatcca tcatccccag tatgcctggc tgcaagacct ggggctccgc       180
     gaggataacg agggcgtgta taatggaagc tggggcggcc ggggagaggt aattacgacc       240
     tattgtcctg ctaacaatga gccaatagca agagtccgac aggccagcct gaaggactat       300
     gaagaaacca tcgggaaagc caagaaagcc tggaacatct gggcagatat tcctgcccca       360
     aagcgaggag aaatagtcag aaagattggc gatgccttcc gggagaagat tcaactactg       420
     ggaagactgg tgtctttgga gatggggaaa atcctcgtgg aaggaatagg cgaggttcag       480
     gagtacgtgg acgtctgtga ctatgctgct ggcttgtcga ggatgatcgg gggacccacc       540
     ttgccttctg aaagacccgg ccatgctctc atcgaaatgt ggaatccctt aggcttggtg       600
     ggaatcatca ctgccttcaa tttccccgtg gctgtgtttg gctggaacaa tgccatagcc       660
     ctgatcacag ggaatgtctg cctttggaaa ggagcaccga ctacgtccct cgttagtgtg       720
     gctgtcacaa agatcatagc ccaggttttg gaggacaacc tgctgcccgg tgccatttgt       780
     tccctggttt gtggtggagc agatatcggc acaacgatgg ccagagatga gcgtgtgaac       840
     ctgctgtcct tcactgggag cactcaggtg gggaaggagg tggccctcat ggtgcaggag       900
     aggtttggga aaagcttgtt ggagcttgga ggaaacaacg ccattattgc tttcgaggac       960
     gcggacctca gcttggttgt tccatcagtt ctgtttgccg ccgtgggaac agctgggcaa      1020
     aggtgtacca ctgtgaggcg actgtttttg cacgaaagca tccataatga agttgtggac      1080
     agactgagaa gtgcctactc acagatccgt gtcgggaacc cctgggaccc caatatcctc      1140
     tatggaccgc tccataccaa acaggcagtg agcatgtttg tgagagccgt ggaagaagcc      1200
     aagaaacaag ggggcacagt ggtctatggg ggcaaggtca tggaccaccc tggcaattac      1260
     gtggaaccca ccattgtgac cggtcttgcc catgatgcgc ccattgttca ccaggagact      1320
     tttgccccaa tcctctatgt cttcaaattc caggatgaag aagaggtctt tgaatggaac      1380
     aatgaagtaa aacagggact ttcaagtagt atctttacca aagatttggg cagaatcttc      1440
     cgctggcttg gacctaaagg ttccgactgt ggcatcgtga acgtcaatat tcctaccagc      1500
     ggggctgaga ttggtggtgc gtttggcgga gagaagcaca ctggcggtgg ccgggagtct      1560
     ggcagcgacg cctggaagca gtacatgagg agatccacat gtaccatcaa ctacagcacg      1620
     tccctccctc tggctcaggg aatcaagttt cagtgatact gcgtgggctt ggcgtccctt      1680
     agccattcct gtggctgctc ggaagaagcc tgaaaggacc ctgacttgcc ccggataaat      1740
     gatggctttg agtacggaca gcagtgtcta atctccagtg attcccagac ccctgtctaa      1800
     atcaagatac tcatttatca aaagttcaaa attaaatatt cacaacctag ctgcatttag      1860
     caaaaaaaaa aaaaaaaaaa a                                                1881
//