Dbfetch

ID   BC012313; SV 1; linear; mRNA; STD; MUS; 2345 BP.
XX
AC   BC012313;
XX
DT   09-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus transferrin, mRNA (cDNA clone MGC:18734 IMAGE:3981648),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2345
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2345
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 92c8e5b156db26e019a49284f70d033a.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 23 Row: k Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20330801.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2345
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:18734 IMAGE:3981648"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2345
FT                   /gene="Trf"
FT                   /note="synonyms: Tfn, Cd176, HP"
FT   misc_difference 14
FT                   /gene="Trf"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   CDS             71..2164
FT                   /codon_start=1
FT                   /gene="Trf"
FT                   /product="transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="InterPro:IPR030685"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAH12313.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   misc_difference 181
FT                   /gene="Trf"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 679
FT                   /gene="Trf"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1996
FT                   /gene="Trf"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2258
FT                   /gene="Trf"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2333..2345
FT                   /gene="Trf"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2345 BP; 591 A; 592 C; 638 G; 524 T; 0 other;
     gccacgggca ggctgcgcag aagcgggtcg gtctgtactc cccgctcctc gccacacaca        60
     caccgagagg atgaggctca ccgtgggtgc cctgctggcc tgcgctgccc tggggctgtg       120
     tctggctgtc cctgacaaaa cggtcaaatg gtgcgcagtg tcagagcacg agaataccaa       180
     atgcatcagc ttccgtgacc acatgaagac cgtccttccg cctgatggcc cccggcttgc       240
     ctgtgtgaag aaaacctcct atccggattg catcaaggcc atttctgcaa gtgaagccga       300
     tgctatgacc ttggatgggg gttgggtgta cgatgccggc ctgactccga acaacctgaa       360
     gcccgtggcg gcggagtttt atggatcagt ggaacatcca cagacctact actacgctgt       420
     ggctgtggta aagaagggaa cagacttcca gctgaaccag ctcgaaggca agaagtcctg       480
     ccacacaggc ctgggaaggt ctgcaggctg ggtcatcccc attggcttgc tcttctgtaa       540
     gctgtcggag ccccgcagtc ctcttgagaa agctgtgtcc agtttcttct cgggcagttg       600
     tgtcccctgt gcagatccag tggccttccc caaactgtgt caactgtgcc caggctgtgg       660
     ctgctcctcc actcaaccgt tctttggcta cgtaggcgca ttcaagtgtc tgaaagatgg       720
     cggtggggat gtggcctttg tcaagcacac aaccatattt gaggtcttgc cggagaaggc       780
     tgacagggac caatatgaac tgctctgcct tgacaatacc cgcaagccag tggatcagta       840
     tgaggattgc tacctggctc ggatcccttc tcatgctgtt gtggctcgaa aaaacaatgg       900
     caaggaagac ttgatctggg agattctcaa agtggcacag gaacactttg gcaaaggcaa       960
     atcaaaagac ttccaactgt tcagctctcc tcttgggaaa gacctgctgt ttaaagattc      1020
     tgcctttggg ctgttaaggg tccccccaag gatggactac aggctgtacc ttggccataa      1080
     ctatgtcact gccattcgga atcagcagga aggcgtgtgc ccggagggct cgatcgacaa      1140
     ctcgccagtg aagtggtgtg cactgagtca cctggagaga accaagtgtg acgagtggag      1200
     catcatcagt gagggaaaga tagagtgtga gtcagcagag accactgagg actgcattga      1260
     aaagattgtg aacggagaag cggacgccat gactttggat ggaggacatg cctacattgc      1320
     aggccagtgt ggtctagtgc ctgtcatggc agagtactac gagagctcta attgtgccat      1380
     cccatcacaa caaggtatct ttcctaaagg gtattatgcc gtggctgtgg tgaaggcatc      1440
     ggacactagc atcacctgga acaacctgaa aggcaagaag tcctgccaca ctggggtaga      1500
     cagaaccgct ggttggaaca tccctatggg catgctgtac aacaggatca accactgcaa      1560
     attcgatgaa tttttcagtc aaggctgcgc tcccgggtat gagaagaatt ccaccctctg      1620
     tgacctgtgt attggcccac tcaaatgtgc tccgaacaac aaagaggaat ataatggtta      1680
     cacaggggct ttcaggtgtc tcgttgagaa aggagatgta gcctttgtga aacaccagac      1740
     tgtcctggat aacaccgaag gaaagaaccc tgccgaatgg gctaagaatc tgaagcagga      1800
     agacttcgag ttgctctgcc ctgatggcac caggaagcct gtgaaagatt ttgccagctg      1860
     ccacctggcc caagctccaa accatgttgt ggtctcacga aaagagaagg cagcccgggt      1920
     taaggctgta ctgactagcc aggagacttt atttggggga agtgactgca ccggcaattt      1980
     ctgtttgttc aagtctacca ccaaggacct tctgttcagg gatgacacca aatgtttcgt      2040
     taaacttcca gagggtacca cacctgaaaa atacttagga gcggagtaca tgcaatctgt      2100
     cggtaacatg aggaagtgct caacctcacg actcctggaa gcctgcactt tccacaaaca      2160
     ttaaaatcca agaggtgggt tgccactgtg gtggagacag atgctccctc ccgtggccca      2220
     tgggcttctc ttggtcttca tgccctgagg ggttgggact aactggtgta gtcttcgctg      2280
     ctgtgcctta ccacatacac agagcacaaa ataaaaacga ctgctgactt taaaaaaaaa      2340
     aaaaa                                                                  2345
//