Dbfetch

ID   BC012269; SV 1; linear; mRNA; STD; MUS; 1724 BP.
XX
AC   BC012269;
XX
DT   09-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus epidermal growth factor-containing fibulin-like extracellular
DE   matrix protein 2, mRNA (cDNA clone MGC:18729 IMAGE:3980048), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1724
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1724
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3cf2f8f5e4a2d782f0c5297ac02bd4ab.
DR   Ensembl-Gn; ENSMUSG00000024909; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024710; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024676; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024649; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024676; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024444; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025123; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024416; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024510; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024629; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024540; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025171; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023662; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023978; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000165485; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050571; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050552; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050505; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050500; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050244; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050997; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050377; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050276; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050243; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050401; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050241; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051109; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049971; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049540; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 23 Row: k Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982689.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1724
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:18729 IMAGE:3980048"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1724
FT                   /gene="Efemp2"
FT                   /note="synonym: MBP1"
FT   CDS             231..1562
FT                   /codon_start=1
FT                   /gene="Efemp2"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2"
FT                   /db_xref="GOA:Q9WVJ9"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR026824"
FT                   /db_xref="MGI:MGI:1891209"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVJ9"
FT                   /protein_id="AAH12269.1"
FT                   /translation="MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEW
FT                   DADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQ
FT                   QPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECV
FT                   DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYG
FT                   TFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLC
FT                   QDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQP
FT                   SSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAML
FT                   VLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF"
FT   misc_difference 1467
FT                   /gene="Efemp2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1630
FT                   /gene="Efemp2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1683
FT                   /gene="Efemp2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1694..1724
FT                   /gene="Efemp2"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1724 BP; 376 A; 496 C; 484 G; 368 T; 0 other;
     gcggggaggc ctgcgcttca cgactcgcgg ggcgggggcg gggcggtccg ggattgcggg        60
     cctgggccat aggcctgcga aaggattctg tccccagccc tggaaggttc cagcctcagc       120
     acagtcctga gacgagacag ctgggaccca ggctcccctt ccagatagag ggaatggggg       180
     gtgctgtggc agaaacccct gacttctgcc caccacctcc cagcctcagg atgctccctt       240
     ttgcctcctg cctccccggg tctttgctgc tctgggcgtt tctgctgttg ctcttgggag       300
     cagcgtcccc acaggatccc gaggagccgg acagctacac ggaatgcaca gatggctatg       360
     agtgggatgc agacagccag cactgccggg atgtcaacga gtgcctgacc atcccggagg       420
     cttgcaaggg tgagatgaaa tgcatcaacc actacggggg ttatttgtgt ctgcctcgct       480
     ctgctgccgt catcagtgat ctccatggtg aaggacctcc accgccagcg gcccatgctc       540
     aacaaccaaa cccttgcccg cagggctacg agcctgatga acaggagagc tgtgtggatg       600
     tggacgagtg tacccaggct ttgcatgact gtcgccctag tcaggactgc cataaccttc       660
     ctggctccta ccagtgcacc tgccctgatg gttaccgaaa aattggaccc gaatgtgtgg       720
     acatagatga gtgtcgttac cgctattgcc agcatcgatg tgtgaacctg ccgggctctt       780
     ttcgatgcca gtgtgagcca ggcttccagt tgggacctaa caaccgctct tgtgtggatg       840
     tgaatgagtg tgacatggga gccccatgtg agcagcgctg cttcaactcc tatgggacct       900
     tcctgtgtcg ctgtaaccag ggctatgagc tgcaccggga tggcttctcc tgcagcgata       960
     tcgatgagtg cggctactcc agttacctct gccagtaccg ctgtgtcaac gagccaggcc      1020
     gattctcctg tcactgccca caaggctacc agctgctggc tacaaggctc tgccaagata      1080
     ttgacgagtg tgaaacaggt gcacaccaat gttctgaggc ccaaacctgt gtcaacttcc      1140
     atgggggtta ccgctgtgtg gacaccaacc gttgtgtgga gccctatgtc caagtgtcag      1200
     acaaccgctg cctctgccct gcctccaatc ccctttgtcg agagcagcct tcatccattg      1260
     tgcaccgcta catgagcatc acctcagagc gaagtgtgcc tgctgacgtg tttcagatcc      1320
     aggcaacctc tgtctaccct ggtgcctaca atgcctttca gatccgttct ggaaacacac      1380
     agggggactt ctacattagg caaatcaaca atgtcagcgc catgctggtc ctcgccaggc      1440
     cagtgacggg accccgggag tacgtgttgg acctggagat ggtcaccatg aattccctta      1500
     tgagctaccg ggccagctct gtactgagac tcacggtctt tgtgggagcc tataccttct      1560
     gaagaccctc agggaagggc catgtggggg cccccttccc cctcccatag cttaagcagc      1620
     cccgggggct tagggatgac cgttctgctt aaaggaacta tgatgtgaag gacaataaag      1680
     ggggaaagaa ggaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa                       1724
//