spacer

EBI Dbfetch

ID   BC011491; SV 1; linear; mRNA; STD; MUS; 1372 BP.
XX
AC   BC011491;
XX
DT   03-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus syntaxin 4A (placental), mRNA (cDNA clone MGC:19006
DE   IMAGE:4016871), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1372
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1372
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 920d5e6228daedd51d0fa464aea257fe.
DR   Ensembl-Gn; ENSMUSG00000030805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121705; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: a Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981984.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1372
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu30"
FT                   /clone="MGC:19006 IMAGE:4016871"
FT                   /tissue_type="Mammary tumor metastatized to lung.
FT                   MMTV-LTR/Wnt1 model. Expression driven by an MMTV-LTR
FT                   enhancer."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1372
FT                   /gene="Stx4a"
FT                   /note="synonyms: Stx4, Syn4"
FT   misc_difference 216
FT                   /gene="Stx4a"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 226
FT                   /gene="Stx4a"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             232..1128
FT                   /codon_start=1
FT                   /gene="Stx4a"
FT                   /product="syntaxin 4A (placental)"
FT                   /db_xref="GOA:P70452"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="MGI:MGI:893577"
FT                   /db_xref="PDB:3PUJ"
FT                   /db_xref="PDB:3PUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70452"
FT                   /protein_id="AAH11491.1"
FT                   /translation="MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKV
FT                   QTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAI
FT                   EPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKIT
FT                   NAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHE
FT                   IFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVS
FT                   VTVLILAVIIGITITVG"
FT   misc_difference 909
FT                   /gene="Stx4a"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
XX
SQ   Sequence 1372 BP; 355 A; 310 C; 434 G; 273 T; 0 other;
     gcaggatggg gggaagagaa gggaattcca acctgtagaa ctttgggggt cctatgatcg        60
     ggttcttccc cacgactgtg gatggtgaaa ggggtggggc ctttggcggc tccggggtgt       120
     actggagttc gctgggtgag ggagggggtg tcaagtgtga gagaggtgca ggacttccaa       180
     atttagaacc ttgaggccct ttgggctcgg gtccaaggca ctccggccac catgcgcgac       240
     aggacccacg agttgaggca gggggataac atctcagacg atgaagatga ggttcgagtc       300
     gcgctggtgg tgcactcagg tgctgcccgg ttgggcagcc cggacgacga gttcttccag       360
     aaggtgcaga caattcggca gactatggcc aaactggaga gtaaagtccg ggagttggag       420
     aaacagcagg tcaccatcct ggccacgcct cttcccgagg agagcatgaa gcagggcctg       480
     cagaacctgc gagaggagat caaacagctg gggagagagg tccgggcgca gctaaaagcc       540
     atagagcccc agaaggagga agctgatgag aattacaact cagtcaacac aaggatgaag       600
     aaaacccagc atggagtcct gtcccagcaa tttgtcgagc tcatcaacaa gtgcaactca       660
     atgcagtccg aataccgaga gaagaatgtg gagcggatcc ggaggcagct gaagatcacc       720
     aatgctggaa tggtgtctga cgaggagctg gaacagatgc tggacagtgg gcagagtgag       780
     gtgtttgtgt ctaatatcct gaaggacacg caggtgactc ggcaggccct gaatgagatc       840
     tctgcgcggc acagtgagat ccagcagttg gagcgcagta tccgagagct ccatgagatc       900
     tttacgttcc tagctacgga ggtggagatg cagggggaga tgatcaaccg catcgagaag       960
     aacatcctga gctcggccga ctacgtggaa cgtgggcaag agcacgtcaa gatagcccta      1020
     gagaatcaga agaaggcgag gaagaaaaaa gtcatgattg ccatctgtgt ctctgtcact      1080
     gttctcatct tggctgtcat cattggcatc accataaccg ttggataatg tcacatgttc      1140
     ttggcattgg gagagacaga gacccagctt ttgtggaggt ggggcaggcc tccaactgaa      1200
     cccgtccgca cactggacct tgtgcagagg gcctgcggct cgtcctgggt tggcagctgc      1260
     tcattcatgg agtcctcccc tggagtcctc cacaatgcct gcgagacagt tttcaatgtc      1320
     ctgtttgtct gggatacatg gttttgtaaa aaatttaaaa aaaaaaaaaa aa              1372
//


spacer
spacer