spacer

EBI Dbfetch

ID   BC011490; SV 1; linear; mRNA; STD; MUS; 3540 BP.
XX
AC   BC011490;
XX
DT   03-AUG-2001 (Rel. 68, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus cholinergic receptor, nicotinic, alpha polypeptide 2
DE   (neuronal), mRNA (cDNA clone MGC:18795 IMAGE:4193582), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3540
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3540
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 04571baa578b79a5e718ad501ac23c80.
DR   Ensembl-Gn; ENSMUSG00000022041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022620; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: j Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450162.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3540
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:18795 IMAGE:4193582"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3540
FT                   /gene="Chrna2"
FT                   /note="synonym: MGC18795"
FT   CDS             117..1655
FT                   /codon_start=1
FT                   /gene="Chrna2"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 2 (neuronal)"
FT                   /db_xref="GOA:Q91X60"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:87886"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91X60"
FT                   /protein_id="AAH11490.1"
FT                   /translation="MAPSHPAFQFWIHLYLWCLLLMPAVLAQQGSHTHAEDRLFKHLFG
FT                   GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEF
FT                   GNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSID
FT                   VTFFPFDQQNCKMKFGSWTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKY
FT                   DCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVL
FT                   LSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMP
FT                   NWVRVALLGRVPRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEE
FT                   EEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHY
FT                   IADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI"
FT   misc_difference 3437
FT                   /gene="Chrna2"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 3528..3540
FT                   /gene="Chrna2"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3540 BP; 867 A; 937 C; 888 G; 848 T; 0 other;
     atgatatggc ctggactcaa agtcacgctt gcagactctg gatgggctgc agagagacag        60
     ggccttgaag aagccagctc cttgtagtcc aacagaaacc aggaccctct gaagccatgg       120
     ccccctccca tcctgctttc cagttctgga tacatcttta tctctggtgt ctgcttctga       180
     tgccagcagt gttggcccag caaggctcgc acacccatgc cgaggaccgc ctgttcaaac       240
     acctctttgg aggctacaat cgctgggcac ggccagtgcc caacacttcc gatgtggtca       300
     tcgtgcgctt tggactatcc attgcacagc tcatagatgt ggatgagaag aatcaaatga       360
     tgaccaccaa tgtctggcta aagcaggaat ggaatgacta caagctgcgc tgggacccgg       420
     ctgagtttgg caacatcacc tccctccgcg tcccctcaga gatgatctgg atcccagaca       480
     ttgttctcta caacaatgca gacggggagt ttgcggtgac ccacatgacc aaggcccacc       540
     tcttcttcac gggcactgtg cactgggtgc ccccagccat ctacaagagc tcctgcagca       600
     tcgacgtgac tttcttcccc ttcgaccagc agaactgcaa gatgaagttt ggctcctgga       660
     catacgacaa ggccaagatc gacctggagc agatggagcg gacggtggac ctgaaggact       720
     actgggagag cggcgagtgg gccattatca acgccaccgg aacctataac agcaagaagt       780
     acgactgctg cgcggagatc taccccgacg tcacctacta cttcgttatc cgccggctgc       840
     cgctgttcta caccatcaac ctcattatcc cgtgcctgct catctcctgc ctcaccgtgc       900
     tcgtgttcta cttgccctct gagtgtggag agaagatcac gctgtgcatc tcggtgctgc       960
     tctccctcac tgtcttcctg ctgctcatca cagaaattat cccatccacc tcactggtca      1020
     tcccactcat cggcgagtac ctgctcttca ccatgatctt cgtcaccctc tctattgtga      1080
     tcacagtctt cgtgctcaat gtccaccacc gttcccctag cacgcacaac atgcccaact      1140
     gggtgagggt ggccctgcta ggccgggtgc cccggtggct gatgatgaat cggcccctgc      1200
     cgcccatgga gctccatggc tctccaggtc tgaagctcag ccccacttat cattggctgg      1260
     agaccaacat ggatgctgaa gaaagggagg agacagagga agaggaggag gaggaagaag      1320
     atgaaaacat atgtatgtgt gcaggcctcc cagactcttc catgggtgtc ctctatggcc      1380
     atggcagcct gcatctgagg gccatggggc ctgaggccaa gactccatcc caggctagtg      1440
     agatcctgct gtcacctcaa atacagaaag cactagaagg tgtacactac attgctgacc      1500
     acctgaggtc tgaggatgct gactcttcgg tgaaggaaga ttggaagtat gtggccatgg      1560
     tggtagaccg gatcttcctc tggctgttca ttatcgtctg cttcctgggg accatcgggc      1620
     tcttcctccc tccgttcctg gctggaatga tctgacttga tgtccctcat gttggctcca      1680
     aggtggcctg gacaaccatc ttctgctctt ctgtgactgg agccatctct agaatattct      1740
     tttgacttaa tgccacctgc ctgcgatgtt tctacgaggc ccctgatcta gcctggactt      1800
     catatcctcc ttgtcaacag ttcatggtgc cattgcggtg acaagcactg agaccactca      1860
     acatgacaac tatttaggga tgctgaggaa ctagaagagg tgaaggctgc tctgtaggtg      1920
     atgacaacat ggtggtgata tggggggaga gcaagatagt tctgaaagag catataggag      1980
     ttgtctatgg caaaagggtc aaacaaaggg atggaggggt cagaccagga caaagggaaa      2040
     tagaacactg gcccaaagat gggcacaagg ggacaatggg agtgcctggt gtggaagagt      2100
     tctgcacaac actgtggatt cagaatgtca gagaggacag ccagctgggg tggggaggct      2160
     gggaggcaag ttgggatatt tttgacccag gcccaagaag aagctcagag tctgcactga      2220
     acctgtctct atgcactttg caggaaatgt cagagggaca ggggtacttc ccaaaggagt      2280
     ggggcacaaa gaaagttcta gagcagtggc tttcaacctg tgtcgtgggt tgcaaccctt      2340
     cagggagtca aacgaccctt tcacaggggt cacatatcag atatcctgca tatcagatgt      2400
     tttacatgac agtccataac aatatcaaaa ttactgttat gaagttgaaa tgaaaacaat      2460
     tttgtggttg gggtcacaac atgaggaact gtaaagggtc atagcattag gaaggttgag      2520
     aaccactgat ctaggtgccc tggtggatgc ttgaggcaga atagcaacat tgggtataag      2580
     ttgctgggcc attattcaac caaaagcact ttggagcctt caagttcccc tcagtgtcat      2640
     gtctcactgt tctatgctac aaaaaaagag gtatagcaat ttctacaagg gatcagggct      2700
     accttcaaat caagaggaca aagtaagaag gcagtctcca atgttggcac ccttcttgct      2760
     gtccacaggg acctggtcct caattcctgg ctctgtcagc atgcctcaca taggaactga      2820
     gatctttgca tcaagctctt tcaattgtgt gctccttcag ggcagagtct ctgctcttgt      2880
     tgctttcact catcctgagc tgggtgagag agctcagtag ctggaccctc catcgtgagt      2940
     agtggagaga aaccaacctg gtagctttag gctccagaac tgctacataa taccaaagct      3000
     ttgggggagg actcttcccc agtcttccca gggccccatc aggtgactaa cctgctctga      3060
     actgtcctgt gtagcttgtt cttttacttg taatattcca cgacccttca ttgcatagaa      3120
     gcccagcgga ttgggccttt cagaacattc tgcagtcccc aaggaattag gtcccagacg      3180
     ctaacagcaa tgagattcag ggtcactaag agatatagag accaagtttg ttctctgtct      3240
     tggggtgctc tccttccgaa ccccacacac agcacctcga cagacctagg agatctgctt      3300
     gtcggaggcc ttacccagac ttcctgttac cagttctaat gatacccact cagtctcagg      3360
     ccttggctcc ccctttctcc actgaatgca gccggcacct cttttctctg tgtcaaaccc      3420
     caagacatga tttcctcatg cagagatgct tgttggatga tccctacccc ccatcctcct      3480
     tgcatgtgag tgaaatgtca aaataaagct aaaatgtctg ccgtcaaaaa aaaaaaaaaa      3540
//


spacer
spacer