spacer

EBI Dbfetch

ID   BC011374; SV 1; linear; mRNA; STD; MUS; 5166 BP.
XX
AC   BC011374;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus low density lipoprotein receptor-related protein 5, mRNA (cDNA
DE   clone MGC:11611 IMAGE:3154246), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5166
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5166
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c2de48e45d9fdf42abbb5c7cbad02644.
DR   Ensembl-Gn; ENSMUSG00000024913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025856; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Chu-Xia Deng Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 16 Row: e Column: 15.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5166
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="129,C57BL/6J,FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam3"
FT                   /clone="MGC:11611 IMAGE:3154246"
FT                   /tissue_type="Mammary tumor. Brca1-/fl; MMTV-Cre model. 10
FT                   months old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..5166
FT                   /gene="Lrp5"
FT                   /note="synonyms: HBM, LR3, LRP7, OPPG, BMND1, mKIAA4142"
FT   CDS             105..4949
FT                   /codon_start=1
FT                   /gene="Lrp5"
FT                   /product="low density lipoprotein receptor-related protein
FT                   5"
FT                   /db_xref="GOA:Q91VN0"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017049"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="MGI:MGI:1278315"
FT                   /protein_id="AAH11374.1"
FT                   /translation="METAPTRAPPPPPPPLLLLVLYCSLVPAAASPLLLFANRRDVRLV
FT                   DAGGVKLESTIVASGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVIS
FT                   GLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGY
FT                   MYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRAN
FT                   LDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPM
FT                   DIQVLSQERQPPFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAE
FT                   EVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRA
FT                   YLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLD
FT                   EPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLY
FT                   WGDAKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKAS
FT                   RDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSD
FT                   MKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVS
FT                   LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQV
FT                   LVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDY
FT                   ADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERAD
FT                   KTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHRCGCASH
FT                   YTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKAINYDPLDKF
FT                   IYWVDGRQNIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCEATNTIN
FT                   VHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFTNMQDHAAKIERASLDGTEREVLFT
FT                   TGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHL
FT                   YWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSH
FT                   ICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACTTGEIDCIPGAWRCDGFPE
FT                   CADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCT
FT                   SGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHSSAIGPVIGIILSLFVMGGV
FT                   YFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFPGIPCSKSVMSSMS
FT                   LVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSGS
FT                   PATARPYRPYVIRGMAPPTTPCSTDVCDSDYSTSRWKSSKYYLDLNSDSDPYPPPPTPH
FT                   SQYLSAEDSCPPSPGTERSYCHLFPPPPSPCTDSS"
FT   misc_difference 1619
FT                   /gene="Lrp5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1700
FT                   /gene="Lrp5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1742
FT                   /gene="Lrp5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1784
FT                   /gene="Lrp5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1832
FT                   /gene="Lrp5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1880
FT                   /gene="Lrp5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2030
FT                   /gene="Lrp5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 4508
FT                   /gene="Lrp5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 4663
FT                   /gene="Lrp5"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; amino acid
FT                   difference: 'S' in cDNA, 'I' in the mouse genome."
FT   misc_difference 5152..5166
FT                   /gene="Lrp5"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 5166 BP; 1134 A; 1547 C; 1467 G; 1018 T; 0 other;
     gcccgaggcg ggagcaagag gcgccgggag ccgcgaggat ccaccgccgc cgcgcgcgcc        60
     atggagcccg agtgagcgcg cggcgctccc ggccgccgga cgacatggaa acggcgccga       120
     cccgggcccc tccgccgccg ccgccgccgc tgctgctgct ggtgctgtac tgcagcttgg       180
     tccccgccgc ggcctcaccg ctcctgttgt ttgccaaccg ccgggatgtg cggctagtgg       240
     atgccggcgg agtgaagctg gagtccacca ttgtggccag tggcctggag gatgcagctg       300
     ctgtagactt ccagttctcc aagggtgctg tgtactggac agatgtgagc gaggaggcca       360
     tcaaacagac ctacctgaac cagactggag ctgctgcaca gaacattgtc atctcgggcc       420
     tcgtgtcacc tgatggcctg gcctgtgact gggttggcaa gaagctgtac tggacggact       480
     ccgagaccaa ccgcattgag gttgccaacc tcaatgggac gtcccgtaag gttctcttct       540
     ggcaggacct ggaccagcca agggccattg ccctggatcc tgcacatggg tacatgtact       600
     ggactgactg gggggaagca ccccggatcg agcgggcagg gatggatggc agtacccgga       660
     agatcattgt agactccgac atttactggc ccaatgggct gaccatcgac ctggaggaac       720
     agaagctgta ctgggccgat gccaagctca gcttcatcca ccgtgccaac ctggacggct       780
     ccttccggca gaaggtggtg gagggcagcc tcactcaccc ttttgccctg acactctctg       840
     gggacacact ctactggaca gactggcaga cccgctccat ccacgcctgc aacaagtgga       900
     caggggagca gaggaaggag atccttagtg ctctgtactc acccatggac atccaagtgc       960
     tgagccagga gcggcagcct cccttccaca caccatgcga ggaggacaac ggtggctgtt      1020
     cccacctgtg cctgctgtcc ccgagggagc ctttctactc ctgtgcctgc cccactggtg      1080
     tgcagttgca ggacaatggc aagacgtgca agacaggggc tgaggaagtg ctgctgctgg      1140
     ctcggaggac agacctgagg aggatctctc tggacacccc tgacttcaca gacatagtgc      1200
     tgcaggtggg cgacatccgg catgccattg ccattgacta cgatcccctg gagggctacg      1260
     tgtactggac cgacgatgag gtgcgggcta tccgcagggc gtacctagat ggctcaggtg      1320
     cgcagacact tgtgaacact gagatcaatg accccgatgg cattgctgtg gactgggtcg      1380
     cccggaacct ctactggaca gatacaggca ctgacagaat tgaggtgact cgcctcaacg      1440
     gcacctcccg aaagatcctg gtatctgagg acctggacga accgcgagcc attgtgttgc      1500
     accctgtgat gggcctcatg tactggacag actgggggga gaaccccaaa atcgaatgcg      1560
     ccaacctaga tgggagagat cggcatgtcc tggtgaacac ctcccttggg tggcccaatg      1620
     gactggccct ggacctgcag gagggcaagc tgtactgggg ggatgccaaa actgataaaa      1680
     tcgaggtgat caacatagac gggacaaagc ggaagaccct gcttgaggac aagctcccac      1740
     acatttttgg gttcacactg ctgggggact tcatctactg gactgactgg cagagacgca      1800
     gtattgaaag ggtccacaag gtcaaggcca gtcgggatgt catcattgat caactccccg      1860
     acctgatggg actcaaagcc gtgaatgtgg ccaaggttgt cggaaccaac ccatgtgcgg      1920
     atggaaatgg agggtgcagc catctgtgct tcttcacccc acgtgccacc aagtgtggct      1980
     gccccattgg cctggagctg ttgagtgaca tgaagacctg cataatccct gaggccttcc      2040
     tggtattcac cagcagagcc accatccaca ggatctccct ggagactaac aacaacgatg      2100
     tggctatccc actcacgggt gtcaaagagg cctctgcact ggactttgat gtgtccaaca      2160
     atcacatcta ctggactgat gtcagcctca agacgatcag ccgagccttc atgaatggga      2220
     gctcagtgga gcacgtgatt gagtttggcc tcgactaccc tgaaggaatg gctgtggact      2280
     ggatgggcaa gaacctctat tgggcggaca cagggaccaa caggattgag gtggcccggc      2340
     tggatgggca gttccggcag gtgcttgtgt ggagagacct tgacaacccc aggtctctgg      2400
     ctctggatcc tactaaaggc tacatctact ggactgagtg gggtggcaag ccaaggattg      2460
     tgcgggcctt catggatggg accaattgta tgacactggt agacaaggtg ggccgggcca      2520
     acgacctcac cattgattat gccgaccagc gactgtactg gactgacctg gacaccaaca      2580
     tgattgagtc ttccaacatg ctgggtcagg agcgcatggt gatagctgac gatctgccct      2640
     acccgtttgg cctgactcaa tatagcgatt acatctactg gactgactgg aacctgcata      2700
     gcattgaacg ggcggacaag accagtgggc ggaaccgcac cctcatccag ggtcacctgg      2760
     acttcgtcat ggacatcctg gtgttccact cctcccgtca ggatggcctc aacgactgcg      2820
     tgcacagcaa tggccagtgt gggcagctgt gcctcgccat ccccggaggc caccgctgtg      2880
     gctgtgcttc acactacacg ctggacccca gcagccgcaa ctgcagcccg ccctccacct      2940
     tcttgctgtt cagccagaaa tttgccatca gccggatgat ccccgatgac cagctcagcc      3000
     cggaccttgt cctacccctt catgggctga ggaacgtcaa agccatcaac tatgacccgc      3060
     tggacaagtt catctactgg gtggacgggc gccagaacat caagagggcc aaggacgacg      3120
     gtacccagcc ctccatgctg acctctccca gccaaagcct gagcccagac agacagccac      3180
     acgacctcag cattgacatc tacagccgga cactgttctg gacctgtgag gccaccaaca      3240
     ctatcaatgt ccaccggctg gatggggatg ccatgggagt ggtgcttcga ggggaccgtg      3300
     acaagccaag ggccattgct gtcaatgctg agcgagggta catgtacttt accaacatgc      3360
     aggaccatgc tgccaagatc gagcgagcct ccctggatgg cacagagcgg gaggtcctct      3420
     tcaccacagg cctcatccgt cccgtggccc ttgtggtgga caatgctctg ggcaagctct      3480
     tctgggtgga tgccgaccta aagcgaatcg aaagctgtga cctctctggg gccaaccgcc      3540
     tgaccctgga agatgccaac atcgtacagc cagtaggtct gacagtgctg ggcaggcacc      3600
     tctactggat cgaccgccag cagcagatga tcgagcgcgt ggagaagacc actggggaca      3660
     agcggactag ggttcagggc cgtgtcaccc acctgacagg catccatgcc gtggaggaag      3720
     tcagcctgga ggagttctca gcccatcctt gtgcccgaga caatggcggc tgctcccaca      3780
     tctgtatcgc caagggtgat ggaacaccgc gctgctcgtg ccctgtccac ctggtgctcc      3840
     tgcagaacct gctgacttgt ggtgagcctc ctacctgctc ccctgatcag tttgcatgta      3900
     ccactggtga gatcgactgc atccccggag cctggcgctg tgacggcttc cctgagtgtg      3960
     ctgaccagag tgatgaagaa ggctgcccag tgtgctccgc ctctcagttc ccctgcgctc      4020
     gaggccagtg tgtggacctg cggttacgct gcgacggtga ggccgactgc caggatcgct      4080
     ctgatgaagc taactgcgat gctgtctgtc tgcccaatca gttccggtgc accagcggcc      4140
     agtgtgtcct catcaagcaa cagtgtgact ccttccccga ctgtgctgat gggtctgatg      4200
     agctcatgtg tgaaatcaac aagccaccct ctgatgacat cccagcccac agcagtgcca      4260
     ttgggcccgt cattggtatc atcctctccc tcttcgtcat gggcggggtc tactttgtct      4320
     gccagcgtgt gatgtgccag cgctacacag gggccagtgg gccctttccc cacgagtatg      4380
     ttggtggagc ccctcatgtg cctctcaact tcatagcccc aggtggctca cagcacggtc      4440
     ccttcccagg catcccgtgc agcaagtccg tgatgagctc catgagcctg gtgggggggc      4500
     gcggcagcgt gcccctctat gaccggaatc acgtcactgg ggcctcatcc agcagctcgt      4560
     ccagcacaaa ggccacacta tatccgccga tcctgaaccc acccccgtcc ccggccacag      4620
     acccctctct ctacaacgtg gacgtgtttt attcttcagg cagcccggcc accgctagac      4680
     catacaggcc ctacgtcatt cgaggtatgg cacccccaac aacaccgtgc agcacagatg      4740
     tgtgtgacag tgactacagc accagtcgct ggaagagcag caaatactac ctggacttga      4800
     attcggactc agacccctac ccccccccgc ccacccccca cagccagtac ctatctgcag      4860
     aggacagctg cccaccctca ccaggcactg agaggagtta ctgccacctc ttcccgcccc      4920
     caccgtcccc ctgcacggac tcgtcctgac ctcggccgtc cacccggccc tgctgcctcc      4980
     ctgtaaatat ttttaaatat gaacaaagga aaaatatatt ttatgattta aaaaataaat      5040
     ataattggga tttttaacaa gtgagaaatg tgagcggtga aggggtgggc agggctggga      5100
     aaactttgta cagtggagaa aatatttata aacttaattt tttaaaacat aaaaaaaaaa      5160
     aaaaaa                                                                 5166
//


spacer
spacer