spacer

EBI Dbfetch

ID   BC011149; SV 1; linear; mRNA; STD; MUS; 1733 BP.
XX
AC   BC011149;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide
DE   6, mRNA (cDNA clone MGC:19296 IMAGE:4037384), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1733
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1733
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ead82c112a5f01d26fc9836b622f0e07.
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: c Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 9790036.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1733
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:19296 IMAGE:4037384"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1733
FT                   /gene="B4galt6"
FT   CDS             161..1309
FT                   /codon_start=1
FT                   /gene="B4galt6"
FT                   /product="UDP-Gal:betaGlcNAc beta
FT                   1,4-galactosyltransferase, polypeptide 6"
FT                   /db_xref="GOA:Q9WVK5"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVK5"
FT                   /protein_id="AAH11149.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
FT   misc_difference 1714..1733
FT                   /gene="B4galt6"
FT                   /note="polyA tail: 20 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1733 BP; 468 A; 420 C; 404 G; 441 T; 0 other;
     gtttctcctt cccggctcgg ttcttctccc cacagcctcc ccggccggac cccgccacct        60
     tcttggggtt ctccgtacat tcatggaagt ttagggcctg gaccgtggcc cggagtctgg       120
     cctgagagcg cagcccgcgc tactggcagg gcagaggaag atgtctgcgc tcaagcggat       180
     gatgcgggtc tccaatcgct ctctgattgc cttcatcttc ttcttctccc tctccacgtc       240
     ctgtctctac ttcatctatg tggctccagg catcgccaac acgtacctct ttatggtaca       300
     agctagaggt atcatgctga gagagaatgt gaaaacaatt ggacacatga tcaggctgta       360
     taccaataaa aacactacgc tcaacggaac agattatcct gaaggcaata atacaagtga       420
     ctatcttgtt caaacaacaa cgtatcttcc gcaaaacttc acgtatttgc cacacctccc       480
     ctgtccagag aagctgcctt acatgcgggg attcctcagt gtcaatgtga gtgagatcag       540
     ttttgatgaa gtccatcagc tcttctccaa ggactcagag attgggccag gaggccactg       600
     gaggcccaaa gactgcaagc ccagatggaa ggtggcagtt ctcatcccct tccgtaaccg       660
     ccatgaacat cttccgattt ttttcctgca cctgattccg atgctccaga aacagcggct       720
     ggaatttgcc ttttatgtca tcgaacagac cggcacacaa ccattcaatc gtgcgatgct       780
     ctttaatgtg ggtttcaaag aggccatgaa agacagagcc tgggactgtg tgatcttcca       840
     tgatgtggat catctgcctg aaaatgatcg gaactactac ggatgtggag agatgccgcg       900
     gcactttgca gcgaagctgg acaagtacat gtacattctt ccctataagg agttttttgg       960
     tggggtgagt ggcctgacgg tggagcaatt caggaagatc aacggctttc ccaatgcctt      1020
     ctggggatgg ggaggcgagg acgatgacct ttggaacaga gttcactacg ccggctacaa      1080
     tgtaacccgg ccagaagggg acttgggaaa atacatatct attcctcatc accatcgagg      1140
     ggaggtacag ttcctaggac ggtataaatt acttcggtat tccaaggagc ggcagtacat      1200
     cgatggactg aacaatttat tatacacacc caaaatactg gttgataggc tgtatacaaa      1260
     tatatctgta aacctcatgc cagaattagc tccaattgaa gactattaaa agaagtcatt      1320
     ctcatggtgg ggtagaccac agtgctggat catgaacttg gcttggagtg ccctcaccgt      1380
     ggaagttaga gattggggtg tatctcagtg tcccggtctg taaaaagagc cagcaatcct      1440
     taatgtttac agcgcgggct ccatccgtca cactctccca ctctccccct gctgggagcg      1500
     tccccccatg gcaagcactg tagagataag aacccattgc ttgggactgg aagtgaagaa      1560
     aactccctac acagagaaga tttttatact gaaatctata atttaattca agagaatgct      1620
     tttatttccg ttcaaacata ttttgtacat atgtgatgta aattaaatgt gttcaaattg      1680
     ttggaaaaca agatgtcaca attttgcatg taaaaaaaaa aaaaaaaaaa aaa             1733
//


spacer
spacer