spacer

EBI Dbfetch

ID   BC010968; SV 1; linear; mRNA; STD; MUS; 710 BP.
XX
AC   BC010968;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 9)
XX
DE   Mus musculus insulin-like 5, mRNA (cDNA clone MGC:13722 IMAGE:4217383),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-710
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-710
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (23-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ca8c3ebd525e4bced215163a88713f11.
DR   Ensembl-Gn; ENSMUSG00000066090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106869; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: o Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754357.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..710
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:13722 IMAGE:4217383"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..710
FT                   /gene="Insl5"
FT                   /note="synonym: RIF2"
FT   misc_difference 1..11
FT                   /gene="Insl5"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             32..439
FT                   /codon_start=1
FT                   /gene="Insl5"
FT                   /product="insulin-like 5"
FT                   /db_xref="GOA:Q9WUG6"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:1346085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUG6"
FT                   /protein_id="AAH10968.1"
FT                   /translation="MKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSR
FT                   WRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLW
FT                   ELKKHSVVSRRDLQALCCREGCSMKELSTLC"
FT   misc_difference 676..710
FT                   /gene="Insl5"
FT                   /note="polyA tail: 35 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 710 BP; 202 A; 181 C; 156 G; 171 T; 0 other;
     ccacgcgtcc gctcatttgc tctccggcag gatgaagggc cccactcttg ctctgtttct        60
     cctcttagtt ctgttggctg tggtggaagt aagaagcagg cagactgtga agctctgtgg       120
     cctggactac gtgagaacag ttatctacat ctgtgccagc tcacggtgga ggagacatct       180
     ggaggggcat ttccactctc aacaagctga gacaagaaac tacctccagc tcctagacag       240
     gcacgagcca tccaagaaaa ctctggagca cagccttccc aagacggatc tctcaggaca       300
     ggagcttgtt cgagatccac aggcacccaa ggaaggtctt tgggaactga agaagcactc       360
     agtggtatcc agacgagatc tgcaagctct gtgctgcagg gaaggctgct ccatgaagga       420
     actcagcacc ctctgttagg atgcgcccaa ccccttggca ggcttcagca tgcatctcaa       480
     tgttctacca tcgagttccc tgttcagctt ctatcactac aaccacggct tttgatcctt       540
     tccttaaagg tctattatgg cttaaagcca ctcttctccc tgtgctgagg tcaatctact       600
     tttctttcta aattctaact actgctttga agtttcgagt gctgtgcaaa attgcaataa       660
     aaaaaaatgc ctgaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                  710
//


spacer
spacer