Dbfetch

ID   BC010804; SV 1; linear; mRNA; STD; MUS; 2078 BP.
XX
AC   BC010804;
XX
DT   18-JUL-2001 (Rel. 68, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus cysteine-rich with EGF-like domains 1, mRNA (cDNA clone
DE   MGC:18896 IMAGE:4239786), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2078
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2078
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 44a63abee7509706084aff4faf6004f2.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031096; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031107; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031566; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030214; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030946; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030900; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031026; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030934; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031593; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029930; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030298; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079344; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079416; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0079338; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079359; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0079834; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079566; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0078944; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079096; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0078980; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079126; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0078985; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0078994; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078087; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 25 Row: d Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 19527147.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2078
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:18896 IMAGE:4239786"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2078
FT                   /gene="Creld1"
FT   CDS             335..1597
FT                   /codon_start=1
FT                   /gene="Creld1"
FT                   /product="cysteine-rich with EGF-like domains 1"
FT                   /db_xref="GOA:Q91XD7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XD7"
FT                   /protein_id="AAH10804.1"
FT                   /translation="MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHP
FT                   CHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDFE
FT                   CHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERPC
FT                   GGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCT
FT                   GPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGC
FT                   MGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
FT   misc_difference 2035..2078
FT                   /gene="Creld1"
FT                   /note="polyA tail: 44 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2078 BP; 443 A; 577 C; 604 G; 454 T; 0 other;
     ggaatatttt gggatccaac cctctctcta attttggccc ctaataactc actgagaccc        60
     taaaacaatg ggctgacgct tattcttttg cccgcgatcc cggccacctc cccctacggt       120
     aacggagaaa taatttctct gctggaatcg tagattaggc tctttcaccc cttccagcgc       180
     ctctgcttcc actaccccag tttatcctcg ttttgtaatt acgtaggtct ggggctctga       240
     gccccaaggc gcctcgcttt cctcccttac agcctggctt ctccagtgaa ccctccccct       300
     gccctctatc tgcacgtccc cagcctggga aaagatggct ccactgcccc caaggggcct       360
     ggtcccatct ctgctctggt gcttgagcct gtttctgagc ctcccaggac ctgtctggct       420
     ccaaccctct cctcctcccc atccttctcc ccgagctgag ccccatccgt gtcatacctg       480
     ccgggcactg gtggacaact tcaacaaggg cctggagaga accatccggg acaacttcgg       540
     gggtggaaac acggcctggg aggaagagaa gttgtccaaa tacaaagaca gtgagacccg       600
     cctggtggag gtgctggagg gcgtgtgcag caggtcagac ttcgagtgcc accgcctgct       660
     cgagctgagc gaggagctgg tggaaaactg gtggtttcac aggcagcagg aagcccccga       720
     cctcttccag tggctctgtt ccgattccct gaagctctgc tgcccctctg gcacctttgg       780
     gccctcctgc ctgccatgtc ctgggggcac agagaggccc tgcggtggct acgggcagtg       840
     tgaaggggaa gggactcgag ggggcagcgg gcactgtgac tgccaagccg gctatggggg       900
     cgaggcctgt ggccagtgtg gccttggcta ctttgaggcg gagcgcaaca gcagccatct       960
     ggtatgttcg gcgtgttttg gtccttgtgc ccgctgcacg ggacctgagg aatcccattg      1020
     tctgcagtgc aagaaaggct gggccctgca tcacctcaag tgtgtagaca tcgatgagtg      1080
     tggtacagag caagccacct gtggagctga ccagttctgt gtgaacacag aaggatccta      1140
     cgagtgccga gactgtgcaa aggcctgcct gggctgtatg ggagcagggc cagggcgctg      1200
     caaaaagtgc agccgtggct accagcaggt gggctccaag tgcctagatg tggatgagtg      1260
     tgagactgtg gtgtgtccag gagagaatga gaagtgtgaa aacacggagg gaggctaccg      1320
     ctgtgtctgt gctgagggct acagacagga ggacggcatc tgcgtgaagg agcaggtccc      1380
     ggagtcggcg ggcttctttg cggagatgac ggaggatgaa atggtggttc tgcagcagat      1440
     gttctttggt gtaatcatct gtgcgctggc cacgcttgct gccaagggtg acttggtgtt      1500
     cactgccatc ttcattggag ctgtggcagc catgactggg tactggttgt cagagcggag      1560
     tgaccgtgtg ctggagggct tcatcaaggg tagataatcc ctgccgccac tcacaggatt      1620
     tcctcccacc caggctgctc ctagaggtta tttctctctc cctatggata cctgggacag      1680
     catagtttct ctttgagact ggggtaaaca cccttttacc tgccttactg agcagcccag      1740
     gaccccagtg gccccagggg gttgaaaaag aggtcctgaa gcagatgcca cgagatccta      1800
     gcctaggaca ctggcaggcc tcaccgtgta tgaatcccaa gacagtttct ccccagggag      1860
     gttgcaggtg ggctttggcc cctgacccgg atgagaggtg tcccctcagg ggtgggcccc      1920
     cataggcccc ttgccaggtg catgctgcca gctccagctg tgtattcacc gcccacgccc      1980
     tagccatcga cttatttatt catctcagga aataaaggac ggtcttgaaa atggaaaaaa      2040
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                              2078
//