Dbfetch

ID   BC010474; SV 1; linear; mRNA; STD; MUS; 1920 BP.
XX
AC   BC010474;
XX
DT   13-JUL-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus dolichyl-phosphate (UDP-N-acetylglucosamine)
DE   acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase), mRNA (cDNA
DE   clone MGC:11562 IMAGE:3965178), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1920
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1920
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 474a9bc24add9fb3a10a42fc819bd0a9.
DR   Ensembl-Gn; ENSMUSG00000032123; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034701; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034682; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034608; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034673; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034384; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035194; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033706; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034356; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034515; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034456; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034596; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034500; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035215; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033412; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033819; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054708; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0092027; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0092101; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0092048; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0092024; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0091601; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0092554; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0092196; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0091533; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0091578; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091754; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0091587; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092871; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0091629; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0090625; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 17 Row: b Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982408.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1920
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:11562 IMAGE:3965178"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1920
FT                   /gene="Dpagt1"
FT   CDS             195..1427
FT                   /codon_start=1
FT                   /gene="Dpagt1"
FT                   /product="dolichyl-phosphate (UDP-N-acetylglucosamine)
FT                   acetylglucosaminephosphotransferase 1 (GlcNAc-1-P
FT                   transferase)"
FT                   /db_xref="GOA:P42867"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="MGI:MGI:1196396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42867"
FT                   /protein_id="AAH10474.1"
FT                   /translation="MWAFPELPLPLPLLVNLIGSLLGFVATVTLIPAFRSHFIAARLCG
FT                   QDLNKLSQQQIPESQGVISGAVFLIILFCFIPFPFLNCFVEEQCKAFPHHEFVALIGAL
FT                   LAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVPKPFRWILGL
FT                   HLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLVELEGDYRDD
FT                   HIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFF
FT                   MPQVFNFLYSLPQLFHIIPCPRHRMPRLNAKTGKLEMSYSKFKTKNLSFLGTFILKVAE
FT                   NLRLVTVHQGESEDGAFTECNNMTLINLLLKVFGPIHERNLTLLLLLLQVLSSAATFSI
FT                   RYQLVRLFYDV"
FT   misc_difference 1906..1920
FT                   /gene="Dpagt1"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1920 BP; 380 A; 559 C; 458 G; 523 T; 0 other;
     gttgcttcct aagagcttct tgctggtcag gagggagggt caggtcctag cgtcctagct        60
     gggttttgtt cccgctggcg ccggaatcct ctgcgggttg ggagccgcac tgccggctgc       120
     cgaggccacg ggattgttcc tggcttacca gttagctgag taggcggcgg ggcggcggcc       180
     accggagggt caccatgtgg gccttcccgg agttgcccct gccgctgccg ctgctggtga       240
     atttgatcgg ctcgctgttg ggattcgtgg ctacagtcac cctcatccct gccttccgta       300
     gccactttat cgccgcgcgc ctctgtggcc aggacctcaa caagctcagc cagcagcaga       360
     tcccagagtc ccagggagtg atcagcggtg ctgttttcct tatcatcctc ttctgcttca       420
     tccctttccc cttcctgaac tgcttcgtgg aggagcagtg taaggcattc ccccaccatg       480
     aatttgtggc cctaataggt gccctccttg ccatctgctg catgatcttc ctggggtttg       540
     ctgatgatgt cctcaatctc cgctggcgcc acaagctgct gctgcccaca gctgcctcac       600
     tacctctcct catggtctac ttcacaaact ttggcaatac aaccatcgtg gtgcccaagc       660
     ccttccgctg gattctgggc ctgcatttgg acttggggat cctgtactac gtctacatgg       720
     ggctgcttgc agtgttctgt accaatgcca tcaacatcct ggcgggcatt aatggcctag       780
     aggccggtca gtcactagtc atctctgctt ctatcattgt cttcaacctg gtggaactgg       840
     aaggtgatta tcgagatgat catatctttt ccctttactt catgatacca tttttcttta       900
     ccaccttggg actgctttac cacaactggt acccgtcccg cgtgtttgtg ggagacacct       960
     tctgttactt tgcgggcatg acttttgccg tggtggggat cttgggacac ttcagcaaga      1020
     ccatgctgct cttctttatg ccacaagtat tcaatttcct ctactcactg cctcagctct      1080
     tccatatcat cccctgccct cgacaccgga tgcccagact caacgcaaag acaggcaaac      1140
     tggaaatgag ctattccaag ttcaagacca agaacctctc tttcctgggc acctttattt      1200
     taaaggtagc agagaacctc cggttagtga cagttcacca aggtgagagt gaggacggtg      1260
     ccttcactga gtgtaacaac atgaccctca tcaacttgct acttaaagtc tttgggccta      1320
     tacatgagag aaacctcacc ctgctcctgc tgctcctgca ggtcctaagc agcgccgcca      1380
     ccttctccat tcgttaccaa ctcgtccgac tcttctatga tgtctgagct ccctgacagc      1440
     tgccctttac ctcacagtct ccattggacc tcagccagga ccagcctctg tctggtccga      1500
     gatgaccctc tggtccaggc ctcgctgaca cttttgttct cagcttctgc catctgtgac      1560
     tactgatatc ctggatggac accttgctgg acttgaagtc cgctagttgg actttgccta      1620
     gggctttcat cttgccttgc cctccctttc tgtcccatct gcagcctcac caggtgggct      1680
     tgtagcctct attatgcaaa tattcgtagc tcagctttca gagcgctaac tctaaaggaa      1740
     ttcacctgag ccttgagaga gaacctgggc tagggctaga gttagggcta catactccaa      1800
     ggtgacctca catttgacta tcaaatgaag tgttgtgatt gggaagcgta gaggcagggc      1860
     catgtgctca gaacggtgac aataaaggac tgccttttac ttgttaaaaa aaaaaaaaaa      1920
//