Dbfetch

ID   BC010459; SV 1; linear; mRNA; STD; MUS; 1598 BP.
XX
AC   BC010459;
XX
DT   13-JUL-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus nucleobindin 2, mRNA (cDNA clone MGC:5832 IMAGE:3585076),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1598
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1598
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e5b36950d94548eea1d3a1ce0df29001.
DR   Ensembl-Gn; ENSMUSG00000030659; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032892; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032875; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032807; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032880; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032590; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033386; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032563; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032715; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032668; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032809; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032700; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033406; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031626; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032031; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032895; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086061; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0086143; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0086082; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086105; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085666; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086602; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086185; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085606; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085802; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085646; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085843; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085687; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086895; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084710; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 10 Row: j Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7949093.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1598
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:5832 IMAGE:3585076"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1598
FT                   /gene="Nucb2"
FT                   /note="synonym: Nefa"
FT   misc_difference 1
FT                   /gene="Nucb2"
FT                   /note="1 base at the 5' end does not align to the mouse
FT                   genome."
FT   CDS             202..1464
FT                   /codon_start=1
FT                   /gene="Nucb2"
FT                   /product="nucleobindin 2"
FT                   /db_xref="GOA:P81117"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028813"
FT                   /db_xref="MGI:MGI:1858179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81117"
FT                   /protein_id="AAH10459.1"
FT                   /translation="MRWRIIQVQYCFLLVPCMLTALEAVPIDVDKTKVHNTEPVENARI
FT                   EPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLD
FT                   ELKRQEVGRLRMLIKAKLDALQDTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAAT
FT                   ADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEESKFEEMKRKHEDHPKVNH
FT                   PGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTRELEKVYNPQ
FT                   NAEDDMIEMEEERLRMREHVMSEIDNNKDRLVTLEEFLRATEKKEFLEPDSWETLDQQQ
FT                   LFTEDELKEYESIIAIQENELKKRAEELQKQKEDLQRQHDHLEAQKQEYHQAVQHLEQK
FT                   KLQQGIAPSGPAGELKFEPHT"
FT   misc_difference 1586..1598
FT                   /gene="Nucb2"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1598 BP; 563 A; 313 C; 399 G; 323 T; 0 other;
     ggcctcgcgc gccgggaccc tgcagagaag aacacaccag tcagtttttc aagggaaaat        60
     cctgggccag gagccaagtc ctgatctcta caaacttaat attgtgtaga ttattttacc       120
     acctgagatc tcagtggcct catctgtgca agaaagagaa aattaaataa taaaaaagat       180
     aaaaccttgg cctgtctgaa gatgaggtgg aggatcatcc aagtacagta ctgttttctc       240
     ttggttccgt gcatgctgac cgctctggaa gctgttccta tcgatgtgga caagaccaaa       300
     gtacacaaca ctgagccagt ggaaaatgca aggatagagc caccagatac tggactttat       360
     tatgatgaat acctcaagca agtgattgaa gtcttggaaa cagatccaca tttcagagaa       420
     aagctccaga aagcagacat agaggagata aggagcggga ggctgagtca agagctggac       480
     ttagtaagtc acaaagtgag gacgagactg gatgagctga agaggcaaga agtaggaaga       540
     ctgcggatgc tcatcaaagc taagctggat gcccttcaag acactggcat gaatcaccac       600
     cttcttctga agcagtttga acacctgaac caccagaatc ctaacacatt tgaatccaga       660
     gatttggata tgctaatcaa agcagctacc gcggatctgg agcaatatga ccggactcgg       720
     catgaagagt ttaagaagta cgagatgatg aaggaacacg agcggagaga gtatttaaaa       780
     acgctgagtg aggagaagag gaaagaagaa gagtctaagt ttgaagagat gaagaggaag       840
     cacgaagacc accccaaagt taatcatccc ggaagcaaag atcaactaaa agaggtttgg       900
     gaagagactg atggattgga ccctaatgac tttgacccca agacattttt caaattacat       960
     gatgttaaca acgatggatt cctggatgaa caagaattag aagcactatt cacaagagag      1020
     ttggagaaag tgtataaccc acaaaatgca gaggacgata tgatagaaat ggaagaggag      1080
     aggctcagga tgagagaaca cgtcatgagt gagattgata acaacaaaga ccgattggtg      1140
     actctggagg aattcctgag agctacagag aagaaagaat tcctggagcc tgatagctgg      1200
     gagacactgg accagcaaca gttattcacc gaggacgagc ttaaagagta tgaaagcatt      1260
     attgctatcc aagagaacga gcttaagaag agggcggaag agctgcagaa acagaaggag      1320
     gatctgcagc ggcagcacga ccacctcgag gcgcagaagc aggagtatca tcaggccgtc      1380
     cagcacctgg aacagaagaa acttcaacaa ggcattgctc catcagggcc agcgggagag      1440
     ctgaagtttg agccacacac ataaagtcct gatgtctgcc agaacttgga agaaaaccgt      1500
     tgattcaaca tctatttcat ctttcaacat cctttctttt ctctccactc aataaatact      1560
     ttaaagcaca tttggaataa aggaaaaaaa aaaaaaaa                              1598
//