spacer

EBI Dbfetch

ID   BC010319; SV 1; linear; mRNA; STD; MUS; 3297 BP.
XX
AC   BC010319;
XX
DT   25-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone IMAGE:3599053), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3297
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3297
RA   Strausberg R.;
RT   ;
RL   Submitted (05-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; b64b1802874830113fb99678d7a316b7.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 16 Row: j Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3297
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="IMAGE:3599053"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2950
FT                   /codon_start=2
FT                   /gene="Atp1a1"
FT                   /product="Atp1a1 protein"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH10319.1"
FT                   /translation="DDHKLSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTT
FT                   PEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGC
FT                   FSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLR
FT                   IISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGD
FT                   RTVMGRIATLASGLEGGQTPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVI
FT                   FLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTL
FT                   TQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENL
FT                   PILKRAVAGDASESALLKCIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNAS
FT                   EPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHL
FT                   LLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVT
FT                   GDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSE
FT                   ELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMG
FT                   IVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFI
FT                   IANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMA
FT                   YGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRK
FT                   IVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYC
FT                   PGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
XX
SQ   Sequence 3297 BP; 795 A; 859 C; 881 G; 762 T; 0 other;
     ggacgaccat aaactcagcc tggatgaact ccatcgtaaa tacggaacag atttgagccg        60
     aggattaaca cctgcaaggg ccgctgagat cctggcccgg gatggcccca acgccctcac       120
     accccctccc actactcccg aatgggtgaa attctgccgg cagctctttg gaggcttttc       180
     catgttactg tggatcgggg ccattctttg tttcctggct tatggcatcc gaagtgctac       240
     agaagaggaa ccgccaaacg atgatctgta cctcggggtg gtgctctctg ctgtagtcat       300
     cataactggc tgtttctcct attatcaaga agcaaaaagc tccaagatca tggaatcctt       360
     caagaacatg gtccctcagc aagcccttgt gattcgaaat ggagagaaaa tgagcatcaa       420
     tgcggaggat gtcgtcgtcg gggatctggt ggaggtgaaa gggggagacc ggatccctgc       480
     tgatcttaga atcatatctg caaacggctg caaggtggat aactcctcac tcactggtga       540
     atcagaaccc cagactcggt ccccggattt cacaaacgag aaccccttgg agacaaggaa       600
     cattgccttc ttctcaacca actgtgtgga aggaaccgca cgtggcatcg tcgtgtacac       660
     tggggaccgc accgtgatgg gcaggattgc cacgcttgcc tctgggctag aaggtggcca       720
     gacccccatt gctgaagaga ttgagcattt catccacctc atcaccgggg tggccgtgtt       780
     cctgggggtg tctttcttca tcctttctct gatccttgag tacacctggc tcgaggctgt       840
     catcttcctc attggtatca tcgtagccaa cgtgccagaa ggtctgctgg ccactgtcac       900
     ggtctgtctg acactcactg ccaagcgcat ggcgaggaag aactgcctgg tgaagaactt       960
     ggaagctgtg gagaccttgg ggtccacatc taccatctgc tcagacaaga cgggaactct      1020
     gactcagaac cggatgacag tggcccacat gtggtttgac aatcagatcc atgaagctga      1080
     caccacggag aatcagagtg gtgtctcctt tgacaagacg tcagccacct ggttcgctct      1140
     gtccagaatt gctggtctct gtaacagggc agtgtttcag gctaaccaag aaaacctgcc      1200
     tattcttaag cgggcagtag cgggagatgc ctctgagtcg gcgctcttaa agtgcattga      1260
     agtctgctgc ggctccgtga tggagatgag ggagaaatac agcaagatag tggagattcc      1320
     cttcaactcc accaacaagt accagttgtc cattcacaag aacccaaatg catctgagcc      1380
     caaacacctg ctagtgatga agggcgcccc agaaaggatc ctggaccgct gcagctccat      1440
     ccttctccac ggcaaggagc agccactgga tgaagagctg aaggacgctt ttcagaacgc      1500
     ctacctagag ctggggggcc ttggagaacg tgtgctaggt ttctgccacc tcctcctgcc      1560
     tgacgaacag tttcccgaag gcttccagtt tgacactgac gatgtcaatt tccccgtgga      1620
     taacctctgc ttcgtgggtc ttatctccat gattgaccct ccccgagctg ctgtccccga      1680
     tgctgtgggc aaatgccgca gcgctgggat taaggtcatc atggttacag gagaccatcc      1740
     aatcacagcg aaagccattg ccaagggggt aggcattatc tcagaaggca atgagactgt      1800
     ggaagacatt gctgcccgcc tcaacattcc agtgaaccag gtgaacccca gagatgccaa      1860
     ggcctgtgtg gtccacggca gtgacctgaa ggacatgacc tccgaggagc tggatgacat      1920
     cttgcggtac cacacagaga tcgtctttgc caggacctct cctcagcaga agctcatcat      1980
     tgtggagggc tgccagcggc agggcgccat cgtggccgtc acaggggatg gtgtcaatga      2040
     ctctccagct ttgaaaaagg cagatattgg ggttgccatg gggattgttg gctctgatgt      2100
     gtccaagcaa gctgctgaca tgatccttct ggatgacaac tttgcctcca ttgtgactgg      2160
     agtagaggaa ggtcgtctga tttttgataa cttgaagaaa tccatcgctt acaccctaac      2220
     cagtaacatt ccggaaatca cccccttctt gatatttatt attgcaaaca ttccactgcc      2280
     cctggggact gtgaccatcc tctgcattga cttgggcact gacatggttc ctgccatctc      2340
     cctggcctac gagcaagctg agagcgacat catgaagagg cagcccagaa accccaaaac      2400
     ggacaaactt gtgaacgagc gtctgatcag catggcctat ggacagatcg gtatgatcca      2460
     ggccctggga ggcttcttca cttactttgt gattctggct gagaacggtt tcctgccctt      2520
     tcacctgttg ggcatccgag agacctggga tgaccgctgg gtcaacgatg tggaggacag      2580
     ctacgggcag cagtggacct acgagcagag gaagatcgtg gagttcacct gccatacagc      2640
     gttctttgtc agtattgtgg tagtgcagtg ggccgacttg gtcatctgca agaccagaag      2700
     gaattctgtc ttccagcagg gaatgaagaa caagatcttg atatttggcc tctttgaaga      2760
     gacagccctt gctgctttct tatcctactg ccccgggatg ggggcagccc ttaggatgta      2820
     tcccctcaaa cctacatggt ggttctgtgc cttcccctac tcccttctca tctttgtgta      2880
     tgacgaggtg cggaagctca ttatcaggcg gcgccctggc ggctgggtgg agaaggaaac      2940
     ctactactag cccactgccc tgcacgccgt ggaacattgt gccacacact gcacccaccc      3000
     ctaccccctc tttgtgtact tcaagtcttg gagctcggaa ctctaccctg gtaggaaagc      3060
     accaaagcat gtggggatgc agacgtcctg gaatgaagca tgtagctgta acggggggcg      3120
     gggcgggggg gagggctgcc tgagaaacac cgtgtacggg gacgacagcg ggcaaggttt      3180
     atacgtgcct ttttgttttt gtaaaaaagg aaaacctgga aagactgaaa gattacgttt      3240
     tatatctgga tttttacaaa taaagatggc tattataacg gaaaaaaaaa aaaaaaa         3297
//


spacer
spacer