spacer

EBI Dbfetch

ID   BC009075; SV 1; linear; mRNA; STD; MUS; 2468 BP.
XX
AC   BC009075;
XX
DT   08-JUN-2001 (Rel. 68, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2,
DE   mRNA (cDNA clone MGC:6892 IMAGE:2654354), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2468
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2468
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e27637809cfe6c6159d62f099cfe42d7.
DR   Ensembl-Gn; ENSMUSG00000051650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055549; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Priscilla Furth
CC   Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: e Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328452.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2468
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="NMRI"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam4"
FT                   /clone="MGC:6892 IMAGE:2654354"
FT                   /tissue_type="Mammary tumor. WAP-Tag model. 5 months old,
FT                   gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2468
FT                   /gene="B3gnt2"
FT                   /note="synonyms: Beta3gnt, beta-3Gnt, B3Galt6"
FT   CDS             129..1322
FT                   /codon_start=1
FT                   /gene="B3gnt2"
FT                   /product="B3gnt2 protein"
FT                   /db_xref="GOA:Q9Z222"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1889505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z222"
FT                   /protein_id="AAH09075.1"
FT                   /translation="MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPK
FT                   EKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMT
FT                   AVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRE
FT                   SWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSL
FT                   KEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGP
FT                   HRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCL
FT                   QKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC"
FT   misc_difference 2451..2468
FT                   /gene="B3gnt2"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2468 BP; 685 A; 509 C; 564 G; 710 T; 0 other;
     ctcatcgtgt ctttgatggc ttcataacct gaaggtccga agaggccaga taggcaccac        60
     cctcaggcct tgggcatcta tctaggtggc tgccgctact atgtacgctg agagcaaagg       120
     tatgagagat gagtgtgggg cgtcgaagag tcaagttgct gggcatcctg atgatggcaa       180
     atgtcttcat ttatttgatt gtggaagtct ccaaaaacag tagccaagac aaaaatggaa       240
     agggaggagt aataatcccg aaagagaagt tctggaagcc acccagcact ccccgggcat       300
     actggaacag ggaacaggag aagctgaaca ggtggtacaa tcccatcttg aacagggtgg       360
     ccaatcagac aggggagcta gccacatctc caaacacaag tcacctgagc tattgtgaac       420
     cagactcgac ggtcatgaca gctgtgacag attttaataa tctgccggac agatttaaag       480
     actttctctt gtatttgaga tgccggaatt actcgctgct tatagatcaa ccgaagaaat       540
     gtgcaaagaa gcccttctta ctattggcga taaagtccct cattccacat tttgccagaa       600
     ggcaagcaat tcgggagtct tggggccgag aaaccaacgt agggaaccag acagtagtga       660
     gggtcttcct gttgggcaag acacccccag aggacaacca ccctgacctt tcggacatgc       720
     ttaagtttga gagtgacaag caccaggaca tcctcatgtg gaactataga gacacattct       780
     tcaacctgtc cctgaaggaa gtgctgtttc ttaggtgggt gagcacttcc tgtccagacg       840
     cagagtttgt cttcaagggc gatgatgacg tgtttgtgaa cacccatcac atccttaatt       900
     acttgaatag cttatccaag agcaaagcca aagacttgtt cataggtgac gtgatccaca       960
     atgctgggcc tcaccgggat aagaaactga agtactacat cccagaagtc ttctacaccg      1020
     gcgtctaccc accgtatgcc gggggtggtg gattcctgta ctccggcccc cttgccttga      1080
     ggctgtacag tgcgactagc cgggtccatc tctaccctat tgatgatgtt tatacgggaa      1140
     tgtgccttca gaaactgggc cttgttccag agaagcacaa aggcttcagg acatttgata      1200
     ttgaagagaa aaataagaaa aatatttgtt cctatataga cctaatgtta gtacatagca      1260
     gaaaacctca agagatgatt gatatctggt ctcagttgca aagtcctaat ttaaaatgct      1320
     gaaatagaca tgagctgcat ttcacagaaa ggcctagcct gactagttcc catggtgtgc      1380
     tctcacaata ggtgagttct gtgtgaggct attagccttc atgagcaggt agcccctggg      1440
     ctcccaagcc ctcagtcctt cccttgcctt gtgaagaggg aaggctgaag acagctcagc      1500
     atggcagggt gagtggttat gacccttcct ctggctgccg gtcctcagtt tctaatttgt      1560
     tttctttctc ctccacaatt atgtatgtat gtgtgtatat atgtgtgtgt gtacatacat      1620
     acatatatat atatgtagga cacaacctgg tggctttgtg aaatggaatt ctatgtattt      1680
     tcataagatt ttgaaagttg tctagaaagt agactgatgt caatctcccg tcacccagca      1740
     gtattgtcct tgttactaga aaccgttact tcctttatgc aaggaaagcc acgcagtgcg      1800
     tgtagttcat cttgtcaggg cttatggcca tgaggacaga ggggattttc tttttacttg      1860
     tgtttggttt cctgggtggc atcatggtag ttaacctatt tttagtattt gaagatcatg      1920
     agtgtgattc cctaatggcc aactggagac tgagtagccc gacagccatg ggtctgtgag      1980
     tgttcagaga ctgggaagca ttcgccactt ctgagctttg gacgtgatta gtcagttaaa      2040
     accccaagat tctattcttg ccatattatc acgtattcct tagataaaat tctgggtagt      2100
     gacacttccc tgtctcagtg tagaagtgcc tgtgctttta tttattgttc agatcaaaca      2160
     ccaaaacatt ttcttaaaaa atattttgtg taatatttta tttgtataca gtgtttgtga      2220
     aatatttaac tagagcatga tattttattt tttctcattt ttaattcttt gagaatttca      2280
     tacaatgtgt tttgattgta ttcacctccc catctcctcc cagatccagc atgatgtttt      2340
     aaatgttaag ctgtaacatg ttagataaag ttaactctta tttttgaatt ttaaaatttg      2400
     gatggggggg tatgaactgc tagagaaaat aaagttctgc caaaatattg aaaaaaaaaa      2460
     aaaaaaaa                                                               2468
//


spacer
spacer