Dbfetch

ID   BC009004; SV 1; linear; mRNA; STD; MUS; 2181 BP.
XX
AC   BC009004;
XX
DT   08-JUN-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus protein phosphatase 1G (formerly 2C), magnesium-dependent,
DE   gamma isoform, mRNA (cDNA clone MGC:6666 IMAGE:3499081), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2181
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2181
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4f1ddc42cfc93237e11b5e9a1ca9b310.
DR   Ensembl-Gn; ENSMUSG00000029147; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029418; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029384; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029334; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029395; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029116; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029848; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028526; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029084; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029233; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029191; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029318; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029220; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029882; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028251; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028607; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031032; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070855; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070934; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070833; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070859; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070505; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071335; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071039; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070445; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070582; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070494; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070656; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070517; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071536; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070511; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069659; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 9 Row: l Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982360.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2181
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:6666 IMAGE:3499081"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2181
FT                   /gene="Ppm1g"
FT   misc_difference 5
FT                   /gene="Ppm1g"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   CDS             124..1752
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform"
FT                   /db_xref="GOA:Q61074"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:106065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61074"
FT                   /protein_id="AAH09004.1"
FT                   /translation="MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNC
FT                   IPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAK
FT                   LTTEEVIKELAQIAGRPTEDEDDKDKVADEDDVDNEEAALLHEEATMTIEELLTRYGQN
FT                   CQKVPPHTKSGIGTGDEPGPQGLNGEAGPEDPSRETPSQENGPTAKGHTGFSSNSEHGT
FT                   EAGQISEPGTATGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEVEEEEDDSEECSEDE
FT                   DGYSSEEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIV
FT                   ANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGD
FT                   HFYKRNKNLPPQEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKIS
FT                   QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVELQAESGKR
FT                   KLEEALSTEGAEDTGNSDKKKAKRD"
FT   misc_difference 2166..2181
FT                   /gene="Ppm1g"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2181 BP; 547 A; 536 C; 637 G; 461 T; 0 other;
     cttgggtcga ctgcgcagcc gggcccgctc cttgccacgc gcgcccccag gggccccggc        60
     tccggcgccg gcaagggtcg cgtcccgctt acctgttcct caggtagcca gccatccgcc       120
     gccatgggtg cctacctctc tcagcccaac acggtgaagt gctccgggga cggggttggc       180
     gccccgcggc tcccgctgcc ctacggcttc tccgccatgc aaggctggcg cgtctccatg       240
     gaggatgctc acaactgtat tcctgagctg gacaatgaga cagccatgtt ttctgtctac       300
     gatggacatg gaggggaaga ggttgccttg tactgtgcca aatatcttcc tgatattatc       360
     aaagatcaga aggcctacaa ggaaggcaag cttcagaagg ctttacaaga tgccttcttg       420
     gctattgatg ccaagctgac cacagaggaa gtcattaagg aactggccca gattgcaggg       480
     agacccactg aagatgagga tgataaagac aaagtagcag atgaggatga tgtggacaat       540
     gaggaggctg cattgttgca tgaagaggct accatgacta ttgaagagct gctgacgcga       600
     tatgggcaga actgtcagaa ggtccctccc cacaccaaat ctggaattgg gacaggcgat       660
     gaaccagggc cccagggcct caatggggag gctggacctg aggacccatc tagggaaact       720
     ccttcccagg aaaatggccc cacagccaaa ggccacacag gcttttcctc caactcggaa       780
     catgggactg aggcaggcca aattagtgag cccggtactg ctaccggtga ggctggacct       840
     tcctgctctt cagcctctga caagctgcct cgagttgcta agtccaagtt ctttgaggac       900
     agtgaagatg aatcagatga ggtggaggaa gaggaggatg acagtgagga atgtagtgag       960
     gacgaggacg gctacagcag tgaggaggca gagaacgagg aagacgagga tgacacggag      1020
     gaggctgaag aggatgatga tgaagagatg atggtccctg gaatggaagg caaagaagag      1080
     cctggttctg acagtggcac aacagcggtg gtggctctga tcagagggaa gcagttgatt      1140
     gtggccaatg caggagactc tcgctgtgtg gtgtccgagg ctggcaaagc tttagatatg      1200
     tcctatgacc acaaaccaga ggatgaagtg gagctggcac gcatcaagaa tgctggtggc      1260
     aaggtcacca tggatggacg agtcaatgga ggcctcaacc tctccagggc cattggagac      1320
     cacttctaca agagaaacaa aaacttgcca ccccaggaac agatgatttc tgcccttcct      1380
     gacatcaagg tgctgactct cactgatgac catgaattca tggtcattgc ttgtgacggc      1440
     atctggaatg tgatgagcag ccaggaggtt gtagacttta ttcaatcaaa gatcagtcaa      1500
     cgtgatgaaa acggggagct tcggttattg tcatccattg tggaagagct gctggatcag      1560
     tgcctggcgc cagacacttc tggggatggt acagggtgtg acaacatgac gtgcatcatc      1620
     atttgcttca agccccgaaa cacagtagag cttcaggcag agagtggcaa gaggaaactg      1680
     gaggaggcac tgtccacgga gggggctgaa gacaccggca acagtgacaa aaagaaggcc      1740
     aagagggact agtggtcaac cggaccctgc ccatgtggac tgttttctga gcccttggac      1800
     ccgagactga gttttgtcct tgtcctttag ccttagcagt gggtatgagg tgtgcagggg      1860
     gctgggtggc tttcctcagc ccattacaaa gagggccccc cacccccccc acgcggcagc      1920
     ctgggaggct ctgctgtcct cttaagcctc cttactctcc ttgggctcat cgactatcgg      1980
     ttctgtgcct gtgctctgtt gtgttggagg gaaggactgg tagttctgat ttttactctg      2040
     tgaacacttt atttaaggac attctttttt attggcggct ctgtgacccc tagccgcttg      2100
     cacccgctct ctgttgtaca ctttcaagca acactttttc agactaaagg ccaaacaaaa      2160
     gctaaaaaaa aaaaaaaaaa a                                                2181
//