Dbfetch

ID   BC008831; SV 2; linear; mRNA; STD; HUM; 1807 BP.
XX
AC   BC008831;
XX
DT   08-JUN-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens RAR-related orphan receptor A, mRNA (cDNA clone MGC:12811
DE   IMAGE:4121602), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1807
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1807
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 237e26bb5871fd33e6502f718f06f2c3.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
XX
CC   On Dec 9, 2003 this sequence version replaced gi:14250723.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 17 Row: f Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 19743902.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1807
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_17"
FT                   /clone="MGC:12811 IMAGE:4121602"
FT                   /tissue_type="Muscle, rhabdomyosarcoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1807
FT                   /gene="RORA"
FT                   /note="synonyms: NR1F1, ROR1, ROR2, ROR3, RZRA"
FT   CDS             9..1580
FT                   /codon_start=1
FT                   /gene="RORA"
FT                   /product="RAR-related orphan receptor A"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000034005.19"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="PDB:4S15"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="AAH08831.1"
FT                   /translation="MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPV
FT                   RRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSN
FT                   ATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKH
FT                   RMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFY
FT                   LDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNIS
FT                   KSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKR
FT                   IDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDF
FT                   ISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQ
FT                   KNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEP
FT                   AMQIDG"
FT   misc_difference 1436
FT                   /gene="RORA"
FT                   /note="'A' in cDNA is 'C' in the human genome; no amino
FT                   acid change."
FT   misc_difference 1774..1807
FT                   /gene="RORA"
FT                   /note="polyA tail: 34 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1807 BP; 585 A; 419 C; 407 G; 396 T; 0 other;
     gaaaaaacat ggagtcagct ccggcagccc ccgaccccgc cgccagcgag ccaggcagca        60
     gcggcgcgga cgcggccgcc ggctccaggg agaccccgct gaaccaggaa tccgcccgca       120
     agagcgagcc gcctgccccg gtgcgcagac agagctattc cagcaccagc agaggtatct       180
     cagtaacgaa gaagacacat acatctcaaa ttgaaattat tccatgcaag atctgtggag       240
     acaaatcatc aggaatccat tatggtgtca ttacatgtga aggctgcaag ggctttttca       300
     ggagaagtca gcaaagcaat gccacctact cctgtcctcg tcagaagaac tgtttgattg       360
     atcgaaccag tagaaaccgc tgccaacact gtcgattaca gaaatgcctt gccgtaggga       420
     tgtctcgaga tgctgtaaaa tttggccgaa tgtcaaaaaa gcagagagac agcttgtatg       480
     cagaagtaca gaaacaccgg atgcagcagc agcagcgcga ccaccagcag cagcctggag       540
     aggctgagcc gctgacgccc acctacaaca tctcggccaa cgggctgacg gaacttcacg       600
     acgacctcag taactacatt gacgggcaca cccctgaggg gagtaaggca gactccgccg       660
     tcagcagctt ctacctggac atacagcctt ccccagacca gtcaggtctt gatatcaatg       720
     gaatcaaacc agaaccaata tgtgactaca caccagcatc aggcttcttt ccctactgtt       780
     cgttcaccaa cggcgagact tccccaactg tgtccatggc agaattagaa caccttgcac       840
     agaatatatc taaatcgcat ctggaaacct gccaatactt gagagaagag ctccagcaga       900
     taacgtggca gaccttttta caggaagaaa ttgagaacta tcaaaacaag cagcgggagg       960
     tgatgtggca attgtgtgcc atcaaaatta cagaagctat acagtatgtg gtggagtttg      1020
     ccaaacgcat tgatggattt atggaactgt gtcaaaatga tcaaattgtg cttctaaaag      1080
     caggttctct agaggtggtg tttatcagaa tgtgccgtgc ctttgactct cagaacaaca      1140
     ccgtgtactt tgatgggaag tatgccagcc ccgacgtctt caaatcctta ggttgtgaag      1200
     actttattag ctttgtgttt gaatttggaa agagtttatg ttctatgcac ctgactgaag      1260
     atgaaattgc attattttct gcatttgtac tgatgtcagc agatcgctca tggctgcaag      1320
     aaaaggtaaa aattgaaaaa ctgcaacaga aaattcagct agctcttcaa cacgtcctac      1380
     agaagaatca ccgagaagat ggaatactaa caaagttaat atgcaaggtg tctacattaa      1440
     gagccttatg tggacgacat acagaaaagc taatggcatt taaagcaata tacccagaca      1500
     ttgtgcgact tcattttcct ccattataca aggagttgtt cacttcagaa tttgagccag      1560
     caatgcaaat tgatgggtaa atgttatcac ctaagcactt ctagaatgtc tgaagtacaa      1620
     acatgaaaaa caaacaaaaa aattaaccga gacactttat atggccctgc acagacctgg      1680
     agcgccacac actgcacatc ttttggtgat cggggtcagg caaaggaggg gaaacaatga      1740
     aaacaaataa aagttgaact tgtttttctc atgaaaaaaa aaaaaaaaaa aaaaaaaaaa      1800
     aaaaaaa                                                                1807
//