spacer

EBI Dbfetch

ID   BC008559; SV 1; linear; mRNA; STD; MUS; 2068 BP.
XX
AC   BC008559;
XX
DT   08-JUN-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus, clone IMAGE:3592890, mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2068
RA   Strausberg R.;
RT   ;
RL   Submitted (25-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 2da364a1401fc654a7afc16c771e3c96.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 11 Row: j Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2068
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="IMAGE:3592890"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1886
FT                   /codon_start=3
FT                   /product="Unknown (protein for IMAGE:3592890)"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAH08559.1"
FT                   /translation="HASGEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYY
FT                   AVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRSPLEKAVSSFFS
FT                   GSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVAFVKHTTIFEVL
FT                   PEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDLIWEILKVAQEH
FT                   FGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVTAIRNQQEGVCP
FT                   EGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKIVNGEADAMTLD
FT                   GGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASDTSITWNNLKGK
FT                   KSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLKCAP
FT                   NNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQEDFELLCPDGT
FT                   RKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTGNFCLFKSTTKD
FT                   LLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTFHKH"
XX
SQ   Sequence 2068 BP; 535 A; 505 C; 559 G; 469 T; 0 other;
     cccacgcgtc cggtgaagcc gatgctatga ccttggatgg gggttgggtg tacgatgccg        60
     gcctgactcc gaacaacctg aagcccgtgg cggcggagtt ttatggatca gtggaacatc       120
     cacagaccta ctactacgct gtggctgtgg taaagaaggg aacagacttc cagctgaacc       180
     agctcgaagg caagaagtcc tgccacacag gcctgggaag gtctgcaggc tgggtcatcc       240
     ccattggctt gctcttctgt aagctgtcgg agccccgcag tcctcttgag aaagctgtgt       300
     ccagtttctt ctcgggcagt tgtgtcccct gtgcagatcc agtggccttc cccaaactgt       360
     gtcaactgtg cccaggctgt ggctgctcct ccactcaacc gttctttggc tacgtaggcg       420
     cattcaagtg tctgaaagat ggcggtgggg atgtggcctt tgtcaagcac acaaccatat       480
     ttgaggtctt gccggagaag gctgacaggg accaatatga actgctctgc cttgacaata       540
     cccgcaagcc agtggatcag tatgaggatt gctacctggc tcggatccct tctcatgctg       600
     ttgtggctcg aaaaaacaat ggcaaggaag acttgatctg ggagattctc aaagtggcac       660
     aggaacactt tggcaaaggc aaatcaaaag acttccaact gttcagctct cctcttggga       720
     aagacctgct gtttaaagat tctgcctttg ggctgttaag ggtcccccca aggatggact       780
     acaggctgta ccttggccat aactatgtca ctgccattcg gaatcagcag gaaggcgtgt       840
     gcccggaggg ctcgatcgac aactcgccag tgaagtggtg tgcactgagt cacctggaga       900
     gaaccaagtg tgacgagtgg agcatcatca gtgagggaaa gatagagtgt gagtcagcag       960
     agaccactga ggactgcatt gaaaagattg tgaacggaga agcggacgcc atgactttgg      1020
     atggaggaca tgcctacatt gcaggccagt gtggtctagt gcctgtcatg gcagagtact      1080
     acgagagctc taattgtgcc atcccatcac aacaaggtat ctttcctaaa gggtattatg      1140
     ccgtggctgt ggtgaaggca tcggacacta gcatcacctg gaacaacctg aaaggcaaga      1200
     agtcctgcca cactggggta gacagaaccg ctggttggaa catccctatg ggcatgctgt      1260
     acaacaggat caaccactgc aaattcgatg aatttttcag tcaaggctgc gctcccgggt      1320
     atgagaagaa ttccaccctc tgtgacctgt gtattggccc actcaaatgt gctccgaaca      1380
     acaaagagga atataatggt tacacagggg ctttcaggtg tctcgttgag aaaggagatg      1440
     tagcctttgt gaaacaccag actgtcctgg ataacaccga aggaaagaac cctgccgaat      1500
     gggctaagaa tctgaagcag gaagacttcg agttgctctg ccctgatggc accaggaagc      1560
     ctgtgaaaga ttttgccagc tgccacctgg cccaagctcc aaaccatgtt gtggtctcac      1620
     gaaaagagaa ggcagcccgg gttaaggctg tactgactag ccaggagact ttatttgggg      1680
     gaagtgactg caccggcaat ttctgtttgt tcaagtctac caccaaggac cttctgttca      1740
     gggatgacac caaatgtttc gttaaacttc cagagggtac cacacctgaa aaatacttag      1800
     gagcggagta catgcaatct gtcggtaaca tgaggaagtg ctcaacctca cgactcctgg      1860
     aagcctgcac tttccacaaa cattaaaatc caagaggtgg gttgccactg tggtggagac      1920
     agatgctccc tcccgtggcc catgggcttc tcttggtctt catgccctga ggggttggga      1980
     ctaactggtg tagtcttcgc tgctgtgcct taccacatac acagagcaca aaataaaaac      2040
     gactgctgac tttaaaaaaa aaaaaaaa                                         2068
//


spacer
spacer