Dbfetch

ID   BC008188; SV 2; linear; mRNA; STD; HUM; 906 BP.
XX
AC   BC008188;
XX
DT   31-MAY-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Homo sapiens Parkinson disease (autosomal recessive, early onset) 7, mRNA
DE   (cDNA clone MGC:5243 IMAGE:2901102), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-906
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-906
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 11f21a9cb787ccd596d27c6df4e6bd70.
DR   Ensembl-Gn; ENSG00000116288; homo_sapiens.
DR   Ensembl-Tr; ENST00000338639; homo_sapiens.
DR   Ensembl-Tr; ENST00000377488; homo_sapiens.
DR   Ensembl-Tr; ENST00000377491; homo_sapiens.
DR   Ensembl-Tr; ENST00000493373; homo_sapiens.
DR   Ensembl-Tr; ENST00000493678; homo_sapiens.
XX
CC   On Aug 25, 2003 this sequence version replaced gi:14198256.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 3 Row: a Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34222306.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..906
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_12"
FT                   /clone="MGC:5243 IMAGE:2901102"
FT                   /tissue_type="Cervix, carcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..906
FT                   /gene="PARK7"
FT                   /note="synonyms: DJ-1, DJ1"
FT   CDS             85..654
FT                   /codon_start=1
FT                   /gene="PARK7"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7"
FT                   /db_xref="GOA:Q99497"
FT                   /db_xref="H-InvDB:HIT000033663.16"
FT                   /db_xref="HGNC:HGNC:16369"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1J42"
FT                   /db_xref="PDB:1P5F"
FT                   /db_xref="PDB:1PDV"
FT                   /db_xref="PDB:1PDW"
FT                   /db_xref="PDB:1PE0"
FT                   /db_xref="PDB:1Q2U"
FT                   /db_xref="PDB:1SOA"
FT                   /db_xref="PDB:1UCF"
FT                   /db_xref="PDB:2OR3"
FT                   /db_xref="PDB:2R1T"
FT                   /db_xref="PDB:2R1U"
FT                   /db_xref="PDB:2R1V"
FT                   /db_xref="PDB:2RK3"
FT                   /db_xref="PDB:2RK4"
FT                   /db_xref="PDB:2RK6"
FT                   /db_xref="PDB:3B36"
FT                   /db_xref="PDB:3B38"
FT                   /db_xref="PDB:3B3A"
FT                   /db_xref="PDB:3BWE"
FT                   /db_xref="PDB:3CY6"
FT                   /db_xref="PDB:3CYF"
FT                   /db_xref="PDB:3CZ9"
FT                   /db_xref="PDB:3CZA"
FT                   /db_xref="PDB:3EZG"
FT                   /db_xref="PDB:3F71"
FT                   /db_xref="PDB:3SF8"
FT                   /db_xref="PDB:4BTE"
FT                   /db_xref="PDB:4MNT"
FT                   /db_xref="PDB:4MTC"
FT                   /db_xref="PDB:4N0M"
FT                   /db_xref="PDB:4N12"
FT                   /db_xref="PDB:4OGF"
FT                   /db_xref="PDB:4OQ4"
FT                   /db_xref="PDB:4P2G"
FT                   /db_xref="PDB:4P34"
FT                   /db_xref="PDB:4P35"
FT                   /db_xref="PDB:4P36"
FT                   /db_xref="PDB:4RKW"
FT                   /db_xref="PDB:4RKY"
FT                   /db_xref="PDB:4S0Z"
FT                   /db_xref="PDB:4ZGG"
FT                   /db_xref="PDB:5IP5"
FT                   /db_xref="PDB:5SY6"
FT                   /db_xref="PDB:5SY9"
FT                   /db_xref="PDB:5SYA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99497"
FT                   /protein_id="AAH08188.1"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAA
FT                   ICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALNGKEVAAQVKAPLVLKD"
FT   misc_difference 318
FT                   /gene="PARK7"
FT                   /note="'T' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 880..906
FT                   /gene="PARK7"
FT                   /note="polyA tail: 27 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 906 BP; 271 A; 181 C; 248 G; 206 T; 0 other;
     ggggtgagtg gtacccaacg ggccggggcg ccgcgtccgc aggaagaggc gcggggtgca        60
     ggcttgtaaa catataacat aaaaatggct tccaaaagag ctctggtcat cctggctaaa       120
     ggagcagagg aaatggagac ggtcatccct gtagatgtca tgaggcgagc tgggattaag       180
     gtcaccgttg caggcctggc tggaaaagac ccagtacagt gtagccgtga tgtggtcatt       240
     tgtcctgatg ccagccttga agatgcaaaa aaagagggac catatgatgt ggtggttcta       300
     ccaggaggta atctgggtgc acagaattta tctgagtctg ctgctgtgaa ggagatactg       360
     aaggagcagg aaaaccggaa gggcctgata gccgccatct gtgcaggtcc tactgctctg       420
     ttggctcatg aaataggttt tggaagtaaa gttacaacac accctcttgc taaagacaaa       480
     atgatgaatg gaggtcatta cacctactct gagaatcgtg tggaaaaaga cggcctgatt       540
     cttacaagcc gggggcctgg gaccagcttc gagtttgcgc ttgcaattgt tgaagccctg       600
     aatggcaagg aggtggcggc tcaagtgaag gctccacttg ttcttaaaga ctagagcagc       660
     gaactgcgac gatcacttag agaaacaggc cgttaggaat ccattctcac tgtgttcgct       720
     ctaaacaaaa cagtggtagg ttaatgtgtt cagaagtcgc tgtccttact acttttgcgg       780
     aagtatggaa gtcacaacta cacagagatt tctcagccta caaattgtgt ctatacattt       840
     ctaagccttg tttgcagaat aaacagggca tttagcaaaa aaaaaaaaaa aaaaaaaaaa       900
     aaaaaa                                                                  906
//