spacer

EBI Dbfetch

ID   BC007920; SV 2; linear; mRNA; STD; HUM; 1218 BP.
XX
AC   BC007920;
XX
DT   16-MAY-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens major histocompatibility complex, class II, DR beta 1, mRNA
DE   (cDNA clone MGC:14111 IMAGE:4309837), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1218
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1218
RA   Director MGC Project;
RT   ;
RL   Submitted (11-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; d8472324669e7060711e820e22d2cbcf.
DR   H-InvDB; HIT000033532_04.4.
XX
CC   On Dec 9, 2003 this sequence version replaced gi:14043971.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Louis Staudt
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 20 Row: p Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 26665892.
CC   Differences found between this sequence and the human genome (build
CC   35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_48"
FT                   /clone="MGC:14111 IMAGE:4309837"
FT                   /tissue_type="Primary B-Cells from Tonsils"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1218
FT                   /gene="HLA-DRB1"
FT                   /note="synonym: HLA-DR1B"
FT   misc_difference 2..3
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TT."
FT   misc_difference 5..9
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ACTTA."
FT   misc_difference 11..19
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAAATCTGT."
FT   misc_difference 21..22
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AG."
FT   misc_difference 24
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'T' in the human genome."
FT   misc_difference 27..30
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCTA."
FT   misc_difference 32..35
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGTT."
FT   misc_difference 37
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome."
FT   misc_difference 39..40
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AT."
FT   misc_difference 42..46
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTCTA."
FT   CDS             47..847
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="HLA-DRB1 protein"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="H-InvDB:HIT000033532_03.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAH07920.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   misc_difference 48..52
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GTACC."
FT   misc_difference 55..56
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AT."
FT   misc_difference 58..59
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AT."
FT   misc_difference 61
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'R' in cDNA, 'S' in the human genome."
FT   misc_difference 63..69
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AAGAGTA."
FT   misc_difference 71..78
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATAATGAC."
FT   misc_difference 82..84
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTT."
FT   misc_difference 86..87
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CC."
FT   misc_difference 89..104
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGATGCAATTATTATC."
FT   misc_difference 106..107
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CT."
FT   misc_difference 109..112
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGAT."
FT   misc_difference 114..115
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TA."
FT   misc_difference 117..122
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTTTCT."
FT   misc_difference 125
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'A' in cDNA, 'P' in the human genome."
FT   misc_difference 127
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'A' in the human genome; no amino
FT                   acid change."
FT   misc_difference 130..135
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATTATT."
FT   misc_difference 137..139
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CCT."
FT   misc_difference 141
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'T' in cDNA, 'N' in the human genome."
FT   misc_difference 143..146
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCCT."
FT   misc_difference 147..157
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGGTCCCAGGA."
FT   misc_difference 160..161
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AA."
FT   misc_difference 163
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'Y' in cDNA, '*' in the human genome."
FT   misc_difference 165..166
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TG."
FT   misc_difference 168..170
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTC."
FT   misc_difference 174..177
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GTAT."
FT   misc_difference 180
FT                   /gene="HLA-DRB1"
FT                   /note="'A' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'H' in cDNA, 'P' in the human genome."
FT   misc_difference 182..183
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CA."
FT   misc_difference 185
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'F' in cDNA, 'L' in the human genome."
FT   misc_difference 189..191
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CCA."
FT   misc_difference 195
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'T' in cDNA, 'K' in the human genome."
FT   misc_difference 197..200
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGCA."
FT   misc_difference 203
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'V' in cDNA, 'M' in the human genome."
FT   misc_difference 205..206
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TA."
FT   misc_difference 208
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'A' in the human genome; no amino
FT                   acid change."
FT   misc_difference 210..211
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CT."
FT   misc_difference 213..215
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CCC."
FT   misc_difference 218..227
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAGAGAAAGA."
FT   misc_difference 229..237
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CGTTATTTG."
FT   misc_difference 239..240
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AG."
FT   misc_difference 243..249
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GACAAAC."
FT   misc_difference 252
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'F' in cDNA, 'Y' in the human genome."
FT   misc_difference 254
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'H' in the human genome."
FT   misc_difference 256
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'E' in the human genome."
FT   misc_difference 259..261
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTC."
FT   misc_difference 263..266
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CACT."
FT   misc_difference 269
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'E' in cDNA, 'Q' in the human genome."
FT   misc_difference 271
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'E' in cDNA, 'D' in the human genome."
FT   misc_difference 274..275
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GG."
FT   misc_difference 278
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'A' in cDNA, 'T' in the human genome."
FT   misc_difference 280..281
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CT."
FT   misc_difference 283
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome; no amino
FT                   acid change."
FT   misc_difference 286..287
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CA."
FT   misc_difference 289..291
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAG."
FT   misc_difference 293..295
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATA."
FT   misc_difference 297..303
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATAGGAC."
FT   misc_difference 305..316
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AATTTTAGGCAA."
FT   misc_difference 319..321
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ACC."
FT   misc_difference 324..326
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CTT."
FT   misc_difference 328..336
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ACTTGCAAG."
FT   misc_difference 338
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'E' in cDNA, 'Q' in the human genome."
FT   misc_difference 340..341
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TC."
FT   misc_difference 344..347
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGTA."
FT   misc_difference 349..350
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TC."
FT   misc_difference 353..354
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TG."
FT   misc_difference 356..366
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AGTAGTTGACT."
FT   misc_difference 368..372
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CCATT."
FT   misc_difference 374..376
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGA."
FT   misc_difference 378..389
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGAGAAATTCAA."
FT   misc_difference 392..407
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AGTTTTAATGTCAAAA."
FT   misc_difference 409
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'Q' in cDNA, 'H' in the human genome."
FT   misc_difference 411..413
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTT."
FT   misc_difference 415
FT                   /gene="HLA-DRB1"
FT                   /note="'A' in cDNA is 'C' in the human genome; no amino
FT                   acid change."
FT   misc_difference 418..421
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATTA."
FT   misc_difference 423..424
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GC."
FT   misc_difference 426..429
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CATA."
FT   misc_difference 431..436
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAGCCT."
FT   misc_difference 438..449
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGGTAAGTTTAG."
FT   misc_difference 451..453
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAT."
FT   misc_difference 455..456
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TT."
FT   misc_difference 458
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'L' in cDNA, 'M' in the human genome."
FT   misc_difference 461..463
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGC."
FT   misc_difference 465..467
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAT."
FT   misc_difference 469
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'H' in cDNA, 'Q' in the human genome."
FT   misc_difference 471..472
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CA."
FT   misc_difference 475..476
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TA."
FT   misc_difference 478..479
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TC."
FT   misc_difference 482..484
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATA."
FT   misc_difference 486..490
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCTGC."
FT   misc_difference 492..504
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGCTACATGCCAA."
FT   misc_difference 506..511
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAGGTG."
FT   misc_difference 513..515
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GAC."
FT   misc_difference 517..518
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GC."
FT   misc_difference 520..525
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGTCAT."
FT   misc_difference 528
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'F' in cDNA, 'C' in the human genome."
FT   misc_difference 530
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'R' in cDNA, 'G' in the human genome."
FT   misc_difference 532
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; no amino
FT                   acid change."
FT   misc_difference 535..541
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CATTTCT."
FT   misc_difference 543..544
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TT."
FT   misc_difference 546..547
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TC."
FT   misc_difference 549..559
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTTGCTCATAT."
FT   misc_difference 561
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'V' in cDNA, 'G' in the human genome."
FT   misc_difference 563..565
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GAT."
FT   misc_difference 568..574
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CTAAACA."
FT   misc_difference 577..578
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TA."
FT   misc_difference 580
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'H' in cDNA, 'Q' in the human genome."
FT   misc_difference 583..584
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CT."
FT   misc_difference 587
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'H' in the human genome."
FT   misc_difference 589
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'E' in the human genome."
FT   misc_difference 597
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'F' in cDNA, 'C' in the human genome."
FT   misc_difference 599..603
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTATG."
FT   misc_difference 605..606
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TA."
FT   misc_difference 608..614
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCATGCT."
FT   misc_difference 616..618
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTC."
FT   misc_difference 621
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'T' in cDNA, 'K' in the human genome."
FT   misc_difference 623
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'V' in cDNA, 'F' in the human genome."
FT   misc_difference 629..631
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCA."
FT   misc_difference 633
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'S' in cDNA, 'T' in the human genome."
FT   misc_difference 635..637
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTG."
FT   misc_difference 639..642
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCCA."
FT   misc_difference 644
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'Y' in cDNA, 'N' in the human genome."
FT   misc_difference 647
FT                   /gene="HLA-DRB1"
FT                   /note="'A' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'T' in cDNA, 'P' in the human genome."
FT   misc_difference 649
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; no amino
FT                   acid change."
FT   misc_difference 651..653
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AAA."
FT   misc_difference 655..657
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAG."
FT   misc_difference 659
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'E' in cDNA, 'K' in the human genome."
FT   misc_difference 661..663
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTC."
FT   misc_difference 665..666
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TT."
FT   misc_difference 668..676
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAATCCTAG."
FT   misc_difference 679..680
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GA."
FT   misc_difference 682..693
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AAGATATTATAG."
FT   misc_difference 695..698
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCAG."
FT   misc_difference 700..701
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GA."
FT   misc_difference 703
FT                   /gene="HLA-DRB1"
FT                   /note="'A' in cDNA is 'C' in the human genome; no amino
FT                   acid change."
FT   misc_difference 705..717
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CTAACTCCCGGTG."
FT   misc_difference 721
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'Q' in cDNA, 'H' in the human genome."
FT   misc_difference 724
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'S' in cDNA, 'R' in the human genome."
FT   misc_difference 726..728
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAG."
FT   misc_difference 730..738
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAGACTCTC."
FT   misc_difference 741..746
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AACAAT."
FT   misc_difference 748..750
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCA."
FT   misc_difference 752..755
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAAT."
FT   misc_difference 757..759
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATA."
FT   misc_difference 762..765
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCTC."
FT   misc_difference 767..773
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCTGGAA."
FT   misc_difference 776
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'A' in cDNA, 'T' in the human genome."
FT   misc_difference 778..782
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCCCT."
FT   misc_difference 784..785
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TG."
FT   misc_difference 787..791
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GTATC."
FT   misc_difference 794
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'F' in cDNA, 'L' in the human genome."
FT   misc_difference 798..800
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AAG."
FT   misc_difference 802..805
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CGTC."
FT   misc_difference 807..809
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CTC."
FT   misc_difference 810
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'G' in cDNA, 'A' in the human genome."
FT   misc_difference 813
FT                   /gene="HLA-DRB1"
FT                   /note="'A' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'H' in cDNA, 'L' in the human genome."
FT   misc_difference 815
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'S' in cDNA, 'P' in the human genome."
FT   misc_difference 817..821
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATTTA."
FT   misc_difference 823..824
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GA."
FT   misc_difference 826..829
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGGC."
FT   misc_difference 832..833
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CA."
FT   misc_difference 834..836
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ACC."
FT   misc_difference 838..841
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATCT."
FT   misc_difference 843..846
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AAAC."
FT   misc_difference 848..854
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CTACGTT."
FT   misc_difference 856..857
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AC."
FT   misc_difference 859..863
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCTCA."
FT   misc_difference 865..879
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTGTAGTTCTGGAAA."
FT   misc_difference 882..886
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ATGTT."
FT   misc_difference 888
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'T' in the human genome."
FT   misc_difference 893..905
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCTCTGTCTTCTG."
FT   misc_difference 908..913
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CATAGT."
FT   misc_difference 917..926
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAAAACTGGA."
FT   misc_difference 928..931
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGAC."
FT   misc_difference 933..935
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCC."
FT   misc_difference 937..938
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AT."
FT   misc_difference 942..950
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AAAATGAGA."
FT   misc_difference 952..960
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CTGCCCAAC."
FT   misc_difference 963..967
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGCCT."
FT   misc_difference 969
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'A' in the human genome."
FT   misc_difference 972..976
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TTCTT."
FT   misc_difference 978..979
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CA."
FT   misc_difference 981..982
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TT."
FT   misc_difference 985..992
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TACATAAA."
FT   misc_difference 994..998
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AGAAA."
FT   misc_difference 1000..1007
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AGGGAAAT."
FT   misc_difference 1009..1014
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TAGAGA."
FT   misc_difference 1016..1020
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CCAGA."
FT   misc_difference 1024..1025
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TG."
FT   misc_difference 1028..1034
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GAATTGT."
FT   misc_difference 1037
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'C' in the human genome."
FT   misc_difference 1039..1040
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AA."
FT   misc_difference 1042..1044
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCA."
FT   misc_difference 1046..1049
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CATT."
FT   misc_difference 1051..1052
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CA."
FT   misc_difference 1054..1055
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AG."
FT   misc_difference 1057..1059
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGC."
FT   misc_difference 1061..1062
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AT."
FT   misc_difference 1064..1066
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TGA."
FT   misc_difference 1068..1071
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CAAA."
FT   misc_difference 1073..1074
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : AG."
FT   misc_difference 1076..1079
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GAAC."
FT   misc_difference 1082..1083
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TT."
FT   misc_difference 1086..1091
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TCATGA."
FT   misc_difference 1094..1103
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : ACAGAATGTG."
FT   misc_difference 1105..1110
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCAAAC."
FT   misc_difference 1112..1116
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CGCTT."
FT   misc_difference 1118..1119
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TG."
FT   misc_difference 1122..1126
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CCGGC."
FT   misc_difference 1128..1133
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GCCAGA."
FT   misc_difference 1135..1150
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : GGTTTGCTGAGGGCAA."
FT   misc_difference 1152..1162
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CACTCCCTGGT."
FT   misc_difference 1164..1218
FT                   /gene="HLA-DRB1"
FT                   /note="polyA tail: 55 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1218 BP; 301 A; 312 C; 329 G; 276 T; 0 other;
     agacttgcct gctgctctgg cccctggtcc tgtcctgttc tccagcatgg tgtgtctgag        60
     gctccctgga ggctcctgca tggcagttct gacagtgaca ctgatggtgc tgagctcccc       120
     actggctttg gctggggaca ccagaccacg tttcttggag tactctacgt ctgagtgtca       180
     tttcttcaat gggacggagc gggtgcggtt cctggacaga tacttccata accaggagga       240
     gaacgtgcgc ttcgacagcg acgtggggga gttccgggcg gtgacggagc tggggcggcc       300
     tgatgccgag tactggaaca gccagaagga catcctggaa gacgagcggg ccgcggtgga       360
     cacctactgc agacacaact acggggttgg tgagagcttc acagtgcagc ggcgagtcca       420
     tcctaaggtg actgtgtatc cttcaaagac ccagcccctg cagcaccaca acctcctggt       480
     ctgttctgtg agtggtttct atccaggcag cattgaagtc aggtggttcc ggaatggcca       540
     ggaagagaag actggggtgg tgtccacagg cctgatccac aatggagact ggaccttcca       600
     gaccctggtg atgctggaaa cagttcctcg gagtggagag gtttacacct gccaagtgga       660
     gcacccaagc gtgacaagcc ctctcacagt ggaatggaga gcacggtctg aatctgcaca       720
     gagcaagatg ctgagtggag tcgggggctt tgtgctgggc ctgctcttcc ttggggccgg       780
     gctgttcatc tacttcagga atcagaaagg acactctgga cttcagccaa gaggattcct       840
     gagctgaagt gcagatgaca cattcaaaga agaactttct gccccagctt tgcaggatga       900
     aaagctttcc ctcctggctg ttattcttcc acaagagagg gctttctcag gacctggttg       960
     ctactggttc agcaactgca gaaaatgtcc tcccttgtgg cttcctcagc tcctgttctt      1020
     ggcctgaagc cccacagctt tgatggcagc gcctcatctt caacttttgt gctccccttt      1080
     gcctaaaccc tatggcctcc tgtgcatctg tactcaccct gtaccacaaa cacattacat      1140
     tattaaatgt ttctcaaaga tggaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1200
     aaaaaaaaaa aaaaaaaa                                                    1218
//


spacer
spacer