spacer

EBI Dbfetch

ID   BC007209; SV 1; linear; mRNA; STD; HUM; 2225 BP.
XX
AC   BC007209;
XX
DT   07-MAY-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens chromosome 7 open reading frame 27, mRNA (cDNA clone
DE   IMAGE:2905978), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2225
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2225
RA   Strausberg R.;
RT   ;
RL   Submitted (01-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e11eb1e07a3bfe2be1ff327149e4fcca.
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC/DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 22 Row: a Column: 17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2225
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_20"
FT                   /clone="IMAGE:2905978"
FT                   /tissue_type="Skin, melanotic melanoma."
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            <1..2225
FT                   /gene="C7orf27"
FT                   /note="synonym: MGC22916"
FT   CDS             <1..1989
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /product="C7orf27 protein"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="H-InvDB:HIT000086757.13"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="AAH07209.1"
FT                   /translation="VASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEE
FT                   SLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLL
FT                   LCVARSPVFSSSDGSLWETVARALSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQ
FT                   PLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQR
FT                   PSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGT
FT                   GPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLR
FT                   ELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPE
FT                   SYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFT
FT                   EWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYA
FT                   VALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSS
FT                   LREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDH
FT                   VEKSPQSLLQDMLATGGFLQGDEADCY"
XX
SQ   Sequence 2225 BP; 370 A; 756 C; 703 G; 396 T; 0 other;
     gtggcctcgg cggccagtca gctcctggtg cacgtcctgg ctttgtccat gcgaggtgga        60
     gccgaggggc agccctgcct gccggggggt gactggcccg cgtgtgccca gaagatcatg       120
     gatcacgttg aagagtcctt gtgctccgcg gccaccccca aggtcactca ggccctgaac       180
     gtcctgacca cgaccttcgg gcgctgccag agcccctgga cggaagccct gtgggtgcgg       240
     ctgagtcccc gcgtggcctg tctgctggag agagacccca tccccgccgc acactcgttc       300
     gtggacctgc ttctctgtgt ggctcgttct cccgtgttca gttcttccga cggcagcctg       360
     tgggagacag tggcgcgggc tctgagctgc ctgggtccca cccacatggg acccctggct       420
     ttggggatcc tgaagctcga gcactgtcca caggcactga ggacccaggc cttccaggtc       480
     cttctccagc ccctggcctg tgtcctgaag gccacggttc aggcccccgg acccccaggc       540
     ttgctggacg ggacggcaga cgatgccacg acggtggaca cactcctggc ctccaagtcg       600
     tcctgcgccg gcctcctgtg ccgcaccctg gctcacctgg aggagctgca gccgctgccc       660
     cagcgccctt caccgtggcc ccaggcgtct ctactggggg ctacagtgac tgtcctgcgg       720
     ctctgtgacg gctcggctgc ccctgcctcc agtgtggggg gccacctctg tgggaccctg       780
     gcgggctgcg tccgggtcca gcgagcagcc ctcgacttcc tggggacgct gtcacagggg       840
     acaggccccc aggagctggt gacgcaggcg cttgctgtcc tcctggagtg cctcgagagc       900
     cccggctcca gccccacggt tctgaagaag gccttccagg ccacgctcag gtggctcctg       960
     agctcaccca agacccccgg ctgctctgat ctcggccccc tcatcccgca gttcctcaga      1020
     gagctgttcc ctgtgctgca gaaacgcctg tgccacccct gctgggaggt gagggactcc      1080
     gccctcgagt tcctgaccca gctgagcagg cactggggag gacaggctga cttcagatgc      1140
     gcactcttgg cttcagaggt gcctcagctg gccctgcagc tcctccagga ccctgagagt      1200
     tatgtccgag cgagtgcagt gaccgccatg gggcagctgt ccagccaggg cctgcacgcc      1260
     cccaccagcc ctgagcatgc agaggcccgg cagagcctgt tcctggagct cctgcacatc      1320
     ctctccgtag actcggaggg cttcccacgg cgggcggtca tgcaagtctt cactgagtgg      1380
     ctgcgggacg gccacgccga cgcggcccag gacacggagc agttcgtggc cactgtgctg      1440
     caggcggcga gccgagacct ggactgggag gtccgcgccc agggcctgga gctggccctc      1500
     gtgttcctgg gccagacttt ggggccgccg cgtacccact gcccctatgc cgtggcccta      1560
     cccgaggtgg ccccagccca gccactcacc gaggcactga gggctctctg ccacgtgggg      1620
     ctctttgact tcgccttttg tgccttgttt gactgcgacc gccctgtggc gcagaagtct      1680
     tgtgacctcc ttctcttcct gagggacaag attgcttcct acagcagcct gcgggaggcc      1740
     aggggcagcc ccaacactgc ctccgcagag gccaccctgc cgaggtggcg ggcgggtgag      1800
     caggcccagc ccccagggga ccaggagcct gaggctgtgc tggccatgct caggtcccta      1860
     gacctggagg gcctgcggag cacgctggcc gagagcagcg accacgtgga aaagagtccc      1920
     cagtccctcc tgcaggacat gctggccacg ggaggcttcc tgcaggggga cgaggccgac      1980
     tgctactgag cagaaccaga gtctgccact ggggctcagg accaagggag gcagcaccat      2040
     gtccttctgt gggacactgc cagccccagg gctccagccc agcccggtgg atcctctggg      2100
     gaagccagga ccaggagaga agcaaggtca agaaatccca cagtttgatg tattaaagaa      2160
     atgacttatt tctactcaaa ataaatggca ttgaagtctt tctttaaaaa aaaaaaaaaa      2220
     aaaaa                                                                  2225
//


spacer
spacer