Dbfetch

ID   BC006966; SV 1; linear; mRNA; STD; MUS; 2038 BP.
XX
AC   BC006966;
XX
DT   04-SEP-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus glutathione reductase, mRNA (cDNA clone IMAGE:3589654),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2038
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2038
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d82e12888bca202fce2f679ad7b6b6fd.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 10 Row: l Column: 24.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2038
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="IMAGE:3589654"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..2038
FT                   /gene="Gsr"
FT   CDS             <1..1130
FT                   /codon_start=3
FT                   /gene="Gsr"
FT                   /product="Gsr protein"
FT                   /db_xref="GOA:Q91Z57"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:95804"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Z57"
FT                   /protein_id="AAH06966.1"
FT                   /translation="DAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVEVNGKKFT
FT                   APHILIATGGVPTVPHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILS
FT                   ALGSKTSLMIRHDKVLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLELQVV
FT                   TSVPGRKPTTTMIPDVDCLLWAIGRDPNSKGLNLNKVGIQTDEKGHILVDEFQNTNVKG
FT                   VYAVGDVCGKALLTPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTE
FT                   DEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQGIGCDEM
FT                   LQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR"
FT   misc_difference 1190
FT                   /gene="Gsr"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1235
FT                   /gene="Gsr"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1343..1345
FT                   /gene="Gsr"
FT                   /note="3 bases in cDNA are not found in the mouse genome."
FT   misc_difference 1923
FT                   /gene="Gsr"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 2002..2038
FT                   /gene="Gsr"
FT                   /note="polyA tail: 37 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2038 BP; 536 A; 440 C; 481 G; 581 T; 0 other;
     gggatgccta tgtgagccgc ctgaacacca tctatcaaaa taatttaacc aagtctcaca        60
     tagaaattat ccacggctat gcaacattcg cagatggtcc tcggcccacg gtggaagtca       120
     atgggaaaaa gtttaccgct ccacacatcc tgattgccac aggaggcgtg cccacagttc       180
     ctcacgagag ccagatccca ggcgccagcc tggggatcac cagtgatggc ttctttcagc       240
     tggaggactt gcccagccgc agcgtcatcg tgggggccgg gtacattgct gtggagatcg       300
     cgggcatcct ctctgccctg ggctccaaga catctcttat gatcaggcat gataaggtac       360
     tgagaaattt tgattcactc atcagttcca actgcaccga ggaactggag aatgccggcg       420
     tggaggtgtt gaagttcaca caggttaagg aagtaaaaaa gacatcatca ggcctggagc       480
     tccaagtggt gacttccgtg cctggtagga agcccaccac gaccatgatt ccagatgttg       540
     actgcctgct ctgggccatt ggacgggacc caaattctaa gggcctgaat ctgaataaag       600
     tgggcattca gacggatgaa aagggccaca tcctagtaga cgaattccag aataccaatg       660
     tcaaaggcgt ctatgctgtg ggagacgtct gtgggaaagc gcttctcacc ccagttgcaa       720
     tcgctgctgg ccggaaactt gcccatagac tgtttgaatg caaacaagat tccaaattag       780
     actatgacaa catccctact gtggtcttca gccacccccc tattgggacc gtggggctca       840
     ctgaagacga agctgttcat aagtatggga aagacaatgt gaaaatctac tcgactgcct       900
     ttaccccgat gtatcacgct gtgaccacga ggaagacgaa atgcgtcatg aagatggttt       960
     gtgccaacaa agaggaaaag gtggttggca ttcacatgca ggggattggc tgtgatgaga      1020
     tgctgcaggg cttcgctgta gcggtgaaaa tgggggccac caaggccgac ttcgacaaca      1080
     cagttgccat tcatcctacc tcttcagagg agctggtcac cctgcgctga gagcctgggg      1140
     acccaggtgg ctagcggtgc gaccagcagg cctccgggag gaaccgatca agtttacgcc      1200
     cagcttctac agatctctgt attttaatca ggaacttctg gtggtgtaaa tttccagcta      1260
     tacacacgca cagaagaact tatgtatcta atcagaaggt tgttttgtta atccggggtt      1320
     ggttttcatt tgataatatt tacgataatt aatattttga tttttttgtt gttgtttaat      1380
     taacagcctt gtgtttgttg tgtttttctt gctttggccc cattccaagt ttaaatgtac      1440
     atgacataca ctcaagttag tgtacctgat ggatgaatat tgctggctaa tttcttttat      1500
     tttttatttt tttccttttt ttatgcagcc caaggtggcc tcaaacaact cagaatcctc      1560
     cagctatagc ctcatgggtg ctggaattct aggcctgcat ggcctctcct ggcctagctt      1620
     gctagtttta tatgatggga agtctgcaga atatacgtgg tatttttgtt ctgtattgga      1680
     aagctgcccc aatgttacct ctctattctt gttttattct ttgctctgtg ttaaatgatt      1740
     taaaatggtt tgtgttattt tcatggaaca aagtgcatta aagttagact tgaggctggt      1800
     taggtaaagg agaaatgaca gtacatgcaa gacggaaggc tgaggcactc gggagccctt      1860
     tcttcttctg agtattcctg gttcattcag tcatttctgt atctctgcgt ttgttttttt      1920
     ttgttttgtt ttgtttttta tgaaaactgt tccaaatttt tgaaattcac tgcattgtct      1980
     tataaaattt attacgaact aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa        2038
//