spacer

EBI Dbfetch

ID   BC006936; SV 1; linear; mRNA; STD; MUS; 1503 BP.
XX
AC   BC006936;
XX
DT   02-MAY-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus glycogen synthase kinase 3 beta, mRNA (cDNA clone MGC:6814
DE   IMAGE:2648507), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1503
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1503
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 457831800d87b27f337f076b63bd605e.
DR   Ensembl-Gn; ENSMUSG00000022812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023507; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: p Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254546.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1503
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:6814 IMAGE:2648507"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1503
FT                   /gene="Gsk3b"
FT                   /note="synonyms: GSK-3, GSK-3beta, GSK3"
FT   misc_difference 1..12
FT                   /gene="Gsk3b"
FT                   /note="12 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             33..1295
FT                   /codon_start=1
FT                   /gene="Gsk3b"
FT                   /product="glycogen synthase kinase 3 beta"
FT                   /db_xref="GOA:Q9WV60"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1861437"
FT                   /db_xref="PDB:4NU1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV60"
FT                   /protein_id="AAH06936.1"
FT                   /translation="MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPG
FT                   QGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKL
FT                   DHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY
FT                   QLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYY
FT                   RAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQI
FT                   REMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFF
FT                   DELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASD
FT                   TNAGDRGQTNNAASASASNST"
FT   misc_difference 1492..1503
FT                   /gene="Gsk3b"
FT                   /note="polyA tail: 12 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1503 BP; 450 A; 362 C; 338 G; 353 T; 0 other;
     cggacgcgtg gggtgattca agaagagcca tcatgtcggg gcgaccgaga accacctcct        60
     ttgcggagag ctgcaagcca gtgcagcagc cttcagcttt tggtagcatg aaagttagca       120
     gagataaaga tggcagcaag gtaaccacag tagtggcaac tcctggccag ggtcctgaca       180
     ggccacagga agtcagttat acagacacga aagtgattgg aaatggatca tttggtgtgg       240
     tatatcaagc caaactttgt gattctggag aactggttgc catcaagaaa gttctacagg       300
     acaagcgatt taagaaccga gagctccaga tcatgagaaa gctagaccac tgtaacatag       360
     tccgactgcg gtatttcttc tactcgagtg gtgagaagaa agatgaggtc taccttaacc       420
     tggtgctgga ctatgttccg gagacagtgt acagagtcgc cagacactat agtcgagcca       480
     agcagacact ccctgtgatc tatgtcaagt tgtatatgta tcagctgttc agaagtctag       540
     cctatatcca ttcctttgga atctgccatc gagacattaa accacagaac ctcttgttgg       600
     atcctgatac agctgtatta aaactctgtg actttggaag tgcaaagcag ctggtccgag       660
     gagagcccaa tgtttcatat atctgttctc ggtactacag ggcaccagag ttgatctttg       720
     gagccactga ttacacgtcc agtatagatg tatggtctgc aggctgtgtg ttggctgaat       780
     tgttgctagg acaaccaata tttcctgggg acagtggtgt ggatcagttg gtggaaataa       840
     taaaggtcct aggaacacca acaagggagc aaattagaga aatgaaccca aattatacag       900
     aattcaaatt ccctcaaatc aaggcacatc cttggacaaa ggtcttccgg ccccgaactc       960
     caccagaggc aattgcactg tgcagccgtc tgctggagta cacacctacc gcccggctaa      1020
     caccactgga agcttgtgca cattcatttt tcgatgaatt gcgggaccca aatgtcaaac      1080
     taccaaatgg gcgagacaca cctgcactct tcaactttac cactcaagaa ctgtcaagta      1140
     acccccctct ggccaccatc cttatccctc cacatgctcg gattcaggcc gctgcttcac      1200
     cgcctgccaa cgccacagca gcctcagata ctaatgctgg agaccgtgga cagaccaata      1260
     acgccgcttc tgcatcagct tccaactcca cctgaacagc ccccaggagc cagctgcgcg      1320
     ggaaagacca gcacttactt gagtgccact cagcaacact ggtcacgttt ggaaagaaaa      1380
     ttaaaaagag gaaaacaaaa acaaaaacaa aaaaaccctg ttcattttag tgttcaattt      1440
     tttttattgt tgttcttatt taaccttgta aaatatctat ataaatacaa aaaaaaaaaa      1500
     aaa                                                                    1503
//


spacer
spacer