spacer

EBI Dbfetch

ID   BC006863; SV 1; linear; mRNA; STD; MUS; 2475 BP.
XX
AC   BC006863;
XX
DT   02-MAY-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus fatty acid amide hydrolase, mRNA (cDNA clone MGC:11634
DE   IMAGE:3595191), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2475
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2475
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 34ac6011e51f08335eb85faec3de34c4.
DR   Ensembl-Gn; ENSMUSG00000034171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049095; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 16 Row: d Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542794.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2475
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:11634 IMAGE:3595191"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2475
FT                   /gene="Faah"
FT   CDS             25..1764
FT                   /codon_start=1
FT                   /gene="Faah"
FT                   /product="fatty acid amide hydrolase"
FT                   /db_xref="GOA:O08914"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="MGI:MGI:109609"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08914"
FT                   /protein_id="AAH06863.1"
FT                   /translation="MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRAR
FT                   QKQRAGLETMDKAVQRFRLQNPDLDSQALLALPLLQLVQKLQSGELSPEAVLFTYLGKA
FT                   WEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVT
FT                   SESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEG
FT                   ALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVG
FT                   PMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTP
FT                   AMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDP
FT                   CLGDLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSV
FT                   IAQWKAMNLDVVLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDD
FT                   AQMEHYKGYFGDMWDNILKKGMKKGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEK
FT                   RPS"
FT   misc_difference 238
FT                   /gene="Faah"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'Q' in cDNA, 'E' in the mouse genome."
FT   misc_difference 2462..2475
FT                   /gene="Faah"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2475 BP; 503 A; 705 C; 696 G; 571 T; 0 other;
     ggtggcggtc ggctgcagga gatcatggtg ctgagcgaag tgtggaccgc gctgtctgga        60
     ctctccgggg tttgcctagc ctgcagcttg ctgtcggcgg cggtggtcct gcgatggacc       120
     aggagccaga ccgcccgggg cgcggtgacc agggcgcggc agaagcagcg agccggcctg       180
     gagaccatgg acaaggcggt gcagcgcttc cggctgcaga atcctgacct ggattcacag       240
     gccttgctgg ctctgcccct gctccaactg gtacagaagt tacagagtgg ggaactgtcc       300
     ccagaagctg tgctctttac ctacctggga aaggcctggg aagtgaacaa agggaccaac       360
     tgtgtgacct cctatctgac tgactgtgag actcagctgt cccaggcccc acggcagggc       420
     ctgctctatg gcgtccccgt gagcctcaag gaatgcttca gctacaaggg ccatgcttcc       480
     acactgggct taagtttgaa cgagggtgtg acatcggaga gtgactgtgt ggtggtgcag       540
     gtactgaagc tgcagggagc tgtgcccttt gtgcacacca acgtccccca gtccatgcta       600
     agctatgact gcagtaaccc cctctttggc cagaccatga acccgtggaa gccctccaag       660
     agtccaggag gttcctcagg gggtgagggg gctctcattg gatctggagg ctcccctctg       720
     ggtttaggca ctgacatcgg cggcagcatc cggttccctt ctgccttctg tggcatctgt       780
     ggcctcaagc ctactgggaa ccgcctcagc aagagtggcc tgaagagctg tgtttatgga       840
     cagacagcag tgcagctttc tgttggcccc atggcacggg atgtggatag cctggcattg       900
     tgcatgaaag ccctactttg tgaggatttg ttccgcttgg actccaccat cccccccttg       960
     cccttcaggg aggagatcta cagaagttct cgaccccttc gtgtgggata ctatgaaact      1020
     gacaactaca ccatgcccac tccagccatg aggagggctg tgatggagac caagcagagt      1080
     ctcgaggctg ctggccacac gctggtcccc ttcttaccaa acaacatacc ttatgccctg      1140
     gaggtcctgt cggcaggtgg gctgttcagt gatggtggct gctcttttct ccaaaacttc      1200
     aaaggcgact ttgtggatcc ctgcttgggg gacctggtct tagtgctgaa gctgcccagg      1260
     tggtttaaaa aactgctgag cttcctgctg aagcctctgt ttcctcggct ggcagccttt      1320
     ctcaacagta tgtgtcctcg gtcagccgaa aagctgtggg aactgcagca tgagattgag      1380
     atgtatcgcc agtccgtcat tgcccagtgg aaggcaatga acttggacgt ggtgctaacc      1440
     cccatgctgg gtcctgctct ggatttgaac acaccgggca gagccacagg ggctatcagc      1500
     tacactgttc tctataactg cctggacttc cctgcggggg tggtgcctgt caccactgtg      1560
     accgctgagg acgatgccca gatggaacac tacaaaggct actttgggga tatgtgggac      1620
     aacattctga agaagggcat gaaaaagggt ataggcctgc ctgtggctgt gcagtgcgtg      1680
     gctctgccct ggcaggaaga gctgtgtctg cggttcatgc gggaggtgga acggctgatg      1740
     acccctgaaa agcggccatc ttgagggtca ttcatctgcc cagctctgga ggacctaagg      1800
     cccatgcgct ctgcactgca gccccatcta ttcaggatcc tgccacccat gaggagatgc      1860
     ccagcacggg aagaggcaac cacctgccct cccctggact cctacagaaa cccaggacat      1920
     gccctccata accaagtctg gaccttgctc ccctttctgg tctactttcc atcctgaccc      1980
     cctactctat gtgacagccc agcaggaacg acacgggcca aggaccacca acagtcaaaa      2040
     aaagcaatgt gtttctgtat ttttctgggt atttttctat taggaccttg gaaccagagc      2100
     ctgctgagag ggctgtgctg tccctccaga gctggctgta atcatgtcac tctcctgctc      2160
     caaagcctcc ctaggccatc acccacaagg tagacacagg gacatgtcct tggcacttgg      2220
     ctcctgccct tccttccttg ttcagattgg ccccagcttt gatggacacc gcccgggtct      2280
     tcctccctca ttccacctct ctctcttctg acttggcctt tttacttctc tagctgttgt      2340
     agagaacaag gtttctctgt gtagccctgg ctgtccagga tctcactctg tagatcaggc      2400
     tggctttcag ctcacaaggc tgcctgcctg ggtgctggga ttaaaggcgt gtgttaccag      2460
     aaaaaaaaaa aaaaa                                                       2475
//


spacer
spacer