Dbfetch

ID   BC006676; SV 1; linear; mRNA; STD; MUS; 2737 BP.
XX
AC   BC006676;
XX
DT   01-MAY-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus CD97 antigen, mRNA (cDNA clone MGC:5704 IMAGE:3499451),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2737
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2737
RA   Strausberg R.;
RT   ;
RL   Submitted (27-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 0e871df95c4933eef3fb8300a31dab3a.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 9 Row: d Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6753359.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2737
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:5704 IMAGE:3499451"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2737
FT                   /gene="Cd97"
FT                   /note="synonym: TM7LN1"
FT   CDS             37..2211
FT                   /codon_start=1
FT                   /product="Cd97 protein"
FT                   /db_xref="GOA:Q9Z0M6"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003056"
FT                   /db_xref="InterPro:IPR009017"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="MGI:MGI:1347095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0M6"
FT                   /protein_id="AAH06676.1"
FT                   /translation="MRGVRCPGLLVVCILLSLSGAGTQKAESKNCAKWCPINSKCVSNR
FT                   SCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLL
FT                   SGAESFVNESENTCQDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPD
FT                   TICQEPPFPTWTLLPTAHSQTLLRFSVEVQNLLRDFNPATVNYTIQKLIEAVDKLLEDP
FT                   METETQQVAAQLLSNLEQSLRTLAQFLPKGPFTYTSPSNTELSLMVKEQDNKDVTTVHH
FT                   GQTWMELDWAVTAGAKISENGSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPI
FT                   PSVSLKLLSNINSVFLTNTNTEKLASNVTFKFDFTSVESIEPRHELICAFWKAHNGNGY
FT                   WDTDGCSMNGTGFCHCNHLTSFAILMAQYHVQDPRLELITKVGLLLSLICLLLCILTFL
FT                   LVKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGEVGLRCRLVAVMLHFCFLAAFCW
FT                   MALEGVELYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDGYGHATYCWLD
FT                   FRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSEINPNMKKLRKARVLTITSIAQ
FT                   LLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVMLCLLNKKVREEYWKWACMV
FT                   TGSKYTEFNSSTTGTGTSQTRALRSSESGM"
FT   misc_feature    241..345
FT                   /note="EGF_CA; Region: Calcium-binding EGF-like domain"
FT   misc_feature    394..501
FT                   /note="EGF_CA; Region: Calcium-binding EGF-like domain"
FT   misc_feature    1186..1320
FT                   /note="GPS; Region: Latrophilin/CL-1-like GPS domain.
FT                   Domain present in latrophilin/CL-1, sea urchin REJ and
FT                   polycystin"
FT   misc_feature    1330..2085
FT                   /note="7tm_2; Region: 7 transmembrane receptor (Secretin
FT                   family)"
XX
SQ   Sequence 2737 BP; 654 A; 763 C; 690 G; 630 T; 0 other;
     caaccccaga cgctgtccgt tccgtgccgc gccaccatga ggggcgtcag atgccccggc        60
     ctgcttgtgg tgtgcatttt actgagtctc tcaggagctg gaacccagaa ggcagagagt       120
     aagaactgtg ccaagtggtg ccctatcaac tcaaaatgtg tcagtaacag aagctgtgtc       180
     tgcaagcccg gcttcagctc ggagaaggaa ttgatcacta accctgcaga gagctgtgaa       240
     gacatcaacg agtgtttact acctggattt tcctgtggag actttgccat gtgtaagaac       300
     tcagagggga gttacacctg cgtctgtaac ctgggatata agctcctttc tggtgcagaa       360
     tcttttgtta acgagagtga gaatacatgt caagatgtgg atgagtgcag ctctgggcag       420
     catcaatgtc acaattccac cgtctgcaaa aacaccgtag gctcctacaa gtgccactgc       480
     cgtccaggtt ggaagccaac ttctgggtcc ctccgtggtc cagacaccat atgccaagag       540
     ccaccgttcc ctacttggac actgctgccc acagcccaca gtcagactct cttgagattc       600
     tctgttgaag tccagaatct gctccgtgac ttcaatccag ccacggtcaa ctacaccatc       660
     cagaaactca tcgaggctgt ggacaagctg ctggaagacc ccatggagac tgaaacccaa       720
     caagtagctg cccagttgct ctcgaacctg gaacaaagcc ttcggacctt ggctcagttt       780
     ttacccaaag gccccttcac ctacacgtcc ccttcaaata ctgaactgtc cctgatggtg       840
     aaggagcaag acaacaaaga tgttaccaca gtgcaccacg gccaaacttg gatggagctg       900
     gactgggctg tgacagctgg agccaaaatc tcagaaaatg gctcctcggt ggcaggcatc       960
     ctgtccagcc caaacatgga aaagctgctg ggcaacaccc cgctgaactt ggagcagaga      1020
     agggcctcct tggaggactt ctatggaagc ccgattccga gtgtctcact taagcttctc      1080
     tcaaacatca attctgtctt cctgaccaac acgaacactg aaaagctcgc ctcgaatgtc      1140
     acgttcaagt tcgactttac ttctgtggag tcaattgagc cacgtcatga gctgatatgt      1200
     gccttctgga aagcccacaa cgggaatggg tactgggaca ccgacggctg ctcaatgaat      1260
     ggcactggct tctgccactg caaccacctg accagctttg ccatcctaat ggctcagtac      1320
     catgtgcagg acccaaggct ggaattgatc accaaggtgg ggctgttgtt gtccctgatc      1380
     tgcctgctgc tgtgcatcct gaccttcctg ctggtgaagc ccatccagag ctctcgaacc      1440
     atggtgcacc tgcacctgtg catctgcctc ttcctgggct caatcatatt cctggtcggc      1500
     gtggagaatg aagggggtga ggtgggcctg cgctgccgcc tggtggccgt gatgctgcat      1560
     ttctgcttcc tggccgcctt ctgctggatg gcactggagg gcgtggagct ctacttcctg      1620
     gtggtgcgtg tgttccaggg ccaaggcctg agtacatggc aacgctgcct gattggctac      1680
     ggggtgcccc tcctcatcgt ggccatctca atggcagttg tcaaaatgga tggctatggg      1740
     catgcaacat actgctggct ggactttagg aagcagggct ttctctggag cttttcggga      1800
     cccgtggcct tcatcatttt ctgcaatgct gccattttcg tgatcactgt ctggaagctc      1860
     acaaagaagt tttctgaaat caacccaaac atgaagaagt taaggaaggc gagggtgctg      1920
     accatcacct ccatcgccca gctccttgtg ctgggctgca cctggggctt cggcctgttc      1980
     ctcttcaacc cccatagcac atggctatcc tacatcttta ccctgctcaa ctgcctgcag      2040
     ggcctattcc tctatgtgat gctctgcctg ctcaacaaaa aggtgaggga agagtactgg      2100
     aaatgggcct gcatggtcac tgggagcaag tacacagagt tcaactcttc cacaacaggc      2160
     actggcacca gccaaacacg ggctctcagg tcctcagaat cagggatgtg aaggcgagtt      2220
     ccatgaagga cagcagcaca tactcacggc tgtcattctg ccttctgttc ctgccacctt      2280
     tcggcctttg accccacttc atataaagaa gggatgcaaa cccagcaatg agccctgcca      2340
     cggggcaagg ggtcgctggt cctgcttctg gttgtctctg cctcaccaca gctactgcct      2400
     accagagaaa cagaatgcag ccagcccaga cctgcagccc actgcctggt acacgaggca      2460
     ggcagtccta ggacaaaggg aagagccctt gagacctggg ctctttgcca gggtgctggg      2520
     ttcagtttcc ttagctaaga ctgtggatgc cacgtcagcc actgaagccc gcctgctgct      2580
     gaggctcacg gtacagaggc ctcgctgctc cacatccagg gcagaaggtc tcacagctaa      2640
     agactaggtt ttgtaatttt tttaacctgt aaacctttca atgttgacac acaaaattaa      2700
     atatcatatt gataaaaaaa aaaaaaaaaa aaaaaaa                               2737
//