Dbfetch

ID   BC006305; SV 2; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   BC006305;
XX
DT   16-APR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Homo sapiens ubiquitin carboxyl-terminal esterase L1 (ubiquitin
DE   thiolesterase), mRNA (cDNA clone MGC:13301 IMAGE:4106766), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1101
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (09-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3cfedc321f506a9cf7cd38ee97cf13ff.
DR   Ensembl-Gn; ENSG00000154277; homo_sapiens.
DR   Ensembl-Tr; ENST00000284440; homo_sapiens.
DR   Ensembl-Tr; ENST00000503431; homo_sapiens.
XX
CC   On Dec 9, 2003 this sequence version replaced gi:13623416.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 17 Row: c Column: 15.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_17"
FT                   /clone="MGC:13301 IMAGE:4106766"
FT                   /tissue_type="Muscle, rhabdomyosarcoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1101
FT                   /gene="UCHL1"
FT                   /note="synonym: PGP9.5"
FT   CDS             37..708
FT                   /codon_start=1
FT                   /gene="UCHL1"
FT                   /product="ubiquitin carboxyl-terminal esterase L1
FT                   (ubiquitin thiolesterase)"
FT                   /db_xref="GOA:P09936"
FT                   /db_xref="H-InvDB:HIT000032743.17"
FT                   /db_xref="HGNC:HGNC:12513"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="PDB:2ETL"
FT                   /db_xref="PDB:2LEN"
FT                   /db_xref="PDB:3IFW"
FT                   /db_xref="PDB:3IRT"
FT                   /db_xref="PDB:3KVF"
FT                   /db_xref="PDB:3KW5"
FT                   /db_xref="PDB:4DM9"
FT                   /db_xref="PDB:4JKJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09936"
FT                   /protein_id="AAH06305.1"
FT                   /translation="MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
FT   misc_difference 1061..1101
FT                   /gene="UCHL1"
FT                   /note="polyA tail: 41 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1101 BP; 303 A; 261 C; 275 G; 262 T; 0 other;
     cttccctagg ctatttctgc cgggcgctcc gcgaagatgc agctcaagcc gatggagatc        60
     aaccccgaga tgctgaacaa agtgctgtcc cggctggggg tcgccggcca gtggcgcttc       120
     gtggacgtgc tggggctgga agaggagtct ctgggctcgg tgccagcgcc tgcctgcgcg       180
     ctgctgctgc tgtttcccct cacggcccag catgagaact tcaggaaaaa gcagattgaa       240
     gagctgaagg gacaagaagt tagtcctaaa gtgtacttca tgaagcagac cattgggaat       300
     tcctgtggca caatcggact tattcacgca gtggccaata atcaagacaa actgggattt       360
     gaggatggat cagttctgaa acagtttctt tctgaaacag agaaaatgtc ccctgaagac       420
     agagcaaaat gctttgaaaa gaatgaggcc atacaggcag cccatgatgc cgtggcacag       480
     gaaggccaat gtcgggtaga tgacaaggtg aatttccatt ttattctgtt taacaacgtg       540
     gatggccacc tctatgaact tgatggacga atgccttttc cggtgaacca tggcgccagt       600
     tcagaggaca ccctgctgaa ggacgctgcc aaggtctgca gagaattcac cgagcgtgag       660
     caaggagaag tccgcttctc tgccgtggct ctctgcaagg cagcctaatg ctctgtggga       720
     gggactttgc tgatttcccc tcttcccttc aacatgaaaa tatatacccc cccatgcagt       780
     ctaaaatgct tcagtacttg tgaaacacag ctgttcttct gttctgcaga cacgccttcc       840
     cctcagccac acccaggcac ttaagcacaa gcagagtgca cagctgtcca ctgggccatt       900
     gtggtgtgag cttcagatgg tgaagcattc tccccagtgt atgtcttgta tccgatatct       960
     aacgctttaa atggctactt tggtttctgt ctgtaagtta agaccttgga tgtggtttaa      1020
     ttgtttgtcc tcaaaaggaa taaaactttt ctgctgataa aaaaaaaaaa aaaaaaaaaa      1080
     aaaaaaaaaa aaaaaaaaaa a                                                1101
//