Dbfetch

ID   BC005791; SV 1; linear; mRNA; STD; MUS; 1296 BP.
XX
AC   BC005791;
XX
DT   05-APR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus syntaxin 4A (placental), mRNA (cDNA clone MGC:12040
DE   IMAGE:3603665), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1296
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1296
RA   Strausberg R.;
RT   ;
RL   Submitted (02-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 51df57511fff22e3388fc9fdb106427a.
DR   Ensembl-Gn; ENSMUSG00000030805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121705; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 17 Row: m Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678176.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1296
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:12040 IMAGE:3603665"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1296
FT                   /gene="Stx4a"
FT                   /note="synonyms: Stx4, Syn4"
FT   CDS             72..968
FT                   /codon_start=1
FT                   /product="Stx4a protein"
FT                   /db_xref="GOA:P70452"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="MGI:MGI:893577"
FT                   /db_xref="PDB:3PUJ"
FT                   /db_xref="PDB:3PUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70452"
FT                   /protein_id="AAH05791.1"
FT                   /translation="MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKV
FT                   QTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAI
FT                   EPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKIT
FT                   NAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHE
FT                   IFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVS
FT                   VTVLILAVIIGITITVG"
FT   misc_feature    192..962
FT                   /note="COG5074; Region: COG5074, t-SNARE complex subunit,
FT                   syntaxin [Intracellular trafficking and secretion]"
XX
SQ   Sequence 1296 BP; 338 A; 317 C; 383 G; 258 T; 0 other;
     gagaggtgca ggacttccaa atttagaacc ttgaggccct ttgggctcgg gtccagggca        60
     ctccgaccac catgcgcgac aggacccacg agttgaggca gggggataac atctcagacg       120
     atgaagatga ggttcgagtc gcgctggtgg tgcactcagg tgctgcccgg ttgggcagcc       180
     cggacgacga gttcttccag aaggtgcaga caattcggca gactatggcc aaactggaga       240
     gtaaagtccg ggagttggag aaacagcagg tcaccatcct ggccacgcct cttcccgagg       300
     agagcatgaa gcagggcctg cagaacctgc gagaggagat caaacagctg gggagagagg       360
     tccgggcgca gctaaaagcc atagagcccc agaaggagga agctgatgag aattacaact       420
     cagtcaacac aaggatgaag aaaacccagc atggagtcct gtcccagcaa tttgtcgagc       480
     tcatcaacaa gtgcaactca atgcagtccg aataccgaga gaagaatgtg gagcggatcc       540
     ggaggcagct gaagatcacc aatgctggaa tggtgtctga cgaggagctg gaacagatgc       600
     tggacagtgg gcagagtgag gtgtttgtgt ctaatatcct gaaggacacg caggtgactc       660
     ggcaggccct gaatgagatc tctgcgcggc acagtgagat ccagcagttg gagcgcagta       720
     tccgagagct ccatgagatc tttacgtttc tagctacgga ggtggagatg cagggggaga       780
     tgatcaaccg catcgagaag aacatcctga gctcggccga ctacgtggaa cgtgggcaag       840
     agcacgtcaa gatagcccta gagaatcaga agaaggcgag gaagaaaaaa gtcatgattg       900
     ccatctgtgt ctctgtcact gttctcatct tggctgtcat cattggcatc accataaccg       960
     ttggataatg tcacatgttc ttggtgagaa atggcgggcc tgccccatcc ctggcagcag      1020
     cctccccgcc tcctgtcaga cccatttctt tctccttccc ttgcaggcat tgggagagac      1080
     agagacccag cttttgtgga ggtggggcag gcctccaact gaacccgtcc gcacactgga      1140
     ccttgtgcag agggcctgcg gctcgtcctg ggttggcagc tgctcattca tggagtcctc      1200
     ccctggagtc ctccacaatg cctgcgagac agttttcaat gtcctgtttg tctgggatac      1260
     atggttttgt aaaaaattta aaaaaaaaaa aaaaaa                                1296
//