Dbfetch

ID   BC005667; SV 1; linear; mRNA; STD; MUS; 820 BP.
XX
AC   BC005667;
XX
DT   05-APR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus adenine phosphoribosyl transferase, mRNA (cDNA clone MGC:11749
DE   IMAGE:3152733), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-820
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-820
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 36be10771e589f88f0cb1ddbd6f2d3fd.
DR   Ensembl-Gn; ENSMUSG00000006589; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034231; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034211; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034138; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033916; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034725; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033243; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033889; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034045; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033988; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034134; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034035; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034743; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032945; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033359; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000006764; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090828; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0090908; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0090849; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090834; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091354; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090971; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090337; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0090550; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090383; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0090578; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090412; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091672; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090403; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089447; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 16 Row: m Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 28313452.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..820
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:11749 IMAGE:3152733"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..820
FT                   /gene="Aprt"
FT                   /note="synonym: MGC11749"
FT   CDS             14..556
FT                   /codon_start=1
FT                   /gene="Aprt"
FT                   /product="adenine phosphoribosyl transferase"
FT                   /db_xref="GOA:P08030"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="MGI:MGI:88061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08030"
FT                   /protein_id="AAH05667.1"
FT                   /translation="MSEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRL
FT                   LASHLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLE
FT                   YGKAELEIQKDALEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLVELTSLK
FT                   GRERLGPIPFFSLLQYD"
FT   misc_difference 806..820
FT                   /gene="Aprt"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 820 BP; 167 A; 240 C; 232 G; 181 T; 0 other;
     cacgcacgcg gccatgtcgg aacctgagtt gaaactggtg gcgcggcgca tccgcagctt        60
     ccccgacttc ccaatcccgg gcgtgctgtt cagggatatc tcgcccctct tgaaagaccc       120
     ggactccttc cgagcttcca tccgcctctt ggccagtcac ctgaagtcca cgcacagcgg       180
     caagatcgac tacatcgcag gtctagactc caggggcttc ctgtttggcc cttccctagc       240
     tcaggagctg ggcgtgggct gtgtgctcat ccggaaacag gggaagctgc cgggccccac       300
     tgtgtcagcc tcctattctc tggagtatgg gaaggctgag ctggaaatcc agaaagatgc       360
     cttggaaccc gggcagagag tggtcattgt ggatgacctc ctggccacag gaggaaccat       420
     gtttgcggcc tgtgacctgc tgcaccagct ccgggctgaa gtggtggagt gtgtgagcct       480
     ggtggagctg acctcgctga agggcaggga gaggctagga cctataccat tcttctctct       540
     cctccagtat gactgaggag ctggctagat ggtcacaccc ctgctcccag cagcaccagg       600
     aactgcttgg tggctcagcc caggcgccta agtgaccttt gtgagctacc ggccgccctt       660
     ttgtgagtgt tatcactcat tcctttggtc agctgatccg ccgtgcctgt ggacccctgg       720
     atccttgtac tttgtacacg tgccacacac cctggagcat agcagagctg tgctactgga       780
     gatcaataaa ccgttttgat atgcaaaaaa aaaaaaaaaa                             820
//