spacer

EBI Dbfetch

ID   BC005631; SV 1; linear; mRNA; STD; MUS; 1469 BP.
XX
AC   BC005631;
XX
DT   05-APR-2001 (Rel. 67, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 16)
XX
DE   Mus musculus aminoacylase 1, mRNA (cDNA clone MGC:11593 IMAGE:3964138),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1469
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1469
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5781c91d525a20b6fff86852ec650634.
DR   Ensembl-Gn; ENSMUSG00000023262; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024031; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 17 Row: o Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 13384745.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1469
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:11593 IMAGE:3964138"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1469
FT                   /gene="Acy1"
FT   misc_difference 1..5
FT                   /gene="Acy1"
FT                   /note="5 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 9
FT                   /gene="Acy1"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 12
FT                   /gene="Acy1"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 78
FT                   /gene="Acy1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             124..1350
FT                   /codon_start=1
FT                   /gene="Acy1"
FT                   /product="aminoacylase 1"
FT                   /db_xref="GOA:Q99JW2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010159"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="MGI:MGI:87913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99JW2"
FT                   /protein_id="AAH05631.1"
FT                   /translation="MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQL
FT                   GLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEG
FT                   YIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPE
FT                   FQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKV
FT                   ISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDV
FT                   DMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEP
FT                   EIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALA
FT                   SVPTLPGES"
FT   misc_difference 561
FT                   /gene="Acy1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 638
FT                   /gene="Acy1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; amino acid
FT                   difference: 'A' in cDNA, 'V' in the mouse genome."
FT   misc_difference 713
FT                   /gene="Acy1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'R' in cDNA, 'Q' in the mouse genome."
FT   misc_difference 864
FT                   /gene="Acy1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1014
FT                   /gene="Acy1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1175
FT                   /gene="Acy1"
FT                   /note="'A' in cDNA is 'T' in the mouse genome; amino acid
FT                   difference: 'Y' in cDNA, 'F' in the mouse genome."
FT   misc_difference 1182
FT                   /gene="Acy1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1339
FT                   /gene="Acy1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'G' in cDNA, 'S' in the mouse genome."
FT   misc_difference 1347
FT                   /gene="Acy1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1442..1469
FT                   /gene="Acy1"
FT                   /note="polyA tail: 28 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1469 BP; 346 A; 399 C; 419 G; 305 T; 0 other;
     cccacgcgtc cgccgggcgg ttttgagatt gggagcgacc tcggtggacc ctgagttccg        60
     gccacagtct gagaggagag cacaggactg agacgtggag agagcaagcc agcacgcggc       120
     gccatgacca ccaaggatcc cgagtctgag cacccctccg tgacgctctt ccgccagtac       180
     ctgcgcatct gcactgtgca acccaatcca gactatggag gggccatcac cttcctggag       240
     gagagagccc gccagctggg tctgagctgt cagaaaatag aggtggtgcc tggctttgtg       300
     atcactgtgc tgacctggcc aggcaccaac ccgtcactcc cctccatctt gctaaactcc       360
     cacacagatg tggtacctgt cttcaaggaa cattggcatc acgacccctt tgaggccttc       420
     aaggattccg agggctacat ctatgctagg ggctcccagg acatgaagag tgtcagcatc       480
     cagtacctgg aagctgtgag gaggctgaag agcgagggcc accgattccc taggaccatc       540
     cacatgacct ttgtgcctga tgaggaggtc ggaggtcaca aggggatgga gttgtttgtg       600
     aagaggcctg agttccaggc tctgcgggca ggcttcgctc tggacgaggg cctggccaac       660
     cccacggatg cctttactgt cttttatagt gagcggagtc cttggtgggt acgggttacc       720
     agcactggga agccaggcca tgcctcacgc ttcattgagg atacagctgc agagaagttg       780
     cataaggtta taagctccat cttggcattc cgggagaagg aaaggcagag gctgcaggcg       840
     aaccctcacc tgaaggaagg cgctgtgact tcggtgaatc tgaccaagct tgaaggtggc       900
     gtggcctata atgtggtacc tgccactatg agtgccagct ttgacttccg agtggcacca       960
     gatgtagaca tgaaggcctt cgagaagcag ctgcagagat ggtgccagga agcgggagag      1020
     ggggtcacct ttgagtttgc tcagaagttt acagagcctc gaatgacacc cacggatgat      1080
     tcagatccct ggtgggcagc tttcagcgga gcctgcaagg caatgaacct cactctggag      1140
     ccagagatct ttcctgctgc cactgacagc cgctatatcc gagcggtggg gatcccagct      1200
     ctgggcttct cgcccatgaa ccgcacacct gtcctgctac atgaccataa tgaacggctg      1260
     catgaggata tatttctccg tggggttgac atatatacag gcctcctctc tgcacttgct      1320
     agtgtgccca ccctgcctgg tgaaagttga gccccagggc ttccaactct tgtactctca      1380
     gtcctaccac tgccaaggat ctgtttcccc tgcccagtaa taaagccagc attggatggg      1440
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                                        1469
//


spacer
spacer